STAU1/Staufen Antikörper (C-Term)
-
- Target Alle STAU1/Staufen (STAU1) Antikörper anzeigen
- STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))
-
Bindungsspezifität
- AA 532-568, C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STAU1/Staufen Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Double-stranded RNA-binding protein Staufen homolog 1(STAU1) detection. Tested with WB in Human.
- Sequenz
- HGIGKDVESC HDMAALNILK LLSELDQQST EMPRTGN
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Double-stranded RNA-binding protein Staufen homolog 1(STAU1) detection. Tested with WB in Human.
Gene Name: staufen double-stranded RNA binding protein 1
Protein Name: Double-stranded RNA-binding protein Staufen homolog 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Staufen (532-568aa HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN), identical to the related mouse sequence.
- Isotyp
- IgG
- Top Product
- Discover our top product STAU1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))
- Andere Bezeichnung
- STAU1 (STAU1 Produkte)
- Synonyme
- STAU1 antikoerper, DKFZp459A0124 antikoerper, CG5753 antikoerper, Dmel\\CG5753 antikoerper, Dmstau antikoerper, STAU antikoerper, Stau antikoerper, Stauf antikoerper, dStau antikoerper, stau antikoerper, XStau antikoerper, XStau1 antikoerper, Staufen antikoerper, Staufen1 antikoerper, MGC145034 antikoerper, 5830401L18Rik antikoerper, AW549911 antikoerper, C85792 antikoerper, fi67e05 antikoerper, wu:fi67e05 antikoerper, zgc:77271 antikoerper, staufen double-stranded RNA binding protein 1 antikoerper, staufen antikoerper, RNA binding protein homolog antikoerper, staufen (RNA binding protein) homolog 1 (Drosophila) antikoerper, staufen double-stranded RNA binding protein 1 L homeolog antikoerper, STAU1 antikoerper, stau antikoerper, stau1 antikoerper, STAUFEN antikoerper, Stau1 antikoerper, stau1.L antikoerper
- Hintergrund
-
Double-stranded RNA-binding protein Staufen homolog 1 is a protein that in humans is encoded by the STAU1 gene. Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described. Three of these variants encode the same isoform, however, differ in their 5'UTR.
Synonyms: Double stranded RNA binding protein Staufen homolog 1 antibody|Double stranded RNA binding protein Staufen homolog antibody|Double-stranded RNA-binding protein Staufen homolog 1 antibody|FLJ25010 antibody|MGC124588 antibody|STAU antibody|STAU1 antibody|STAU1_HUMAN antibody|staufen antibody|Staufen RNA binding protein (Drosophila) antibody|Staufen RNA binding protein homolog 1 antibody|Staufen, RNA binding protein, homolog 1 (Drosophila) antibody - Gen-ID
- 6780
- UniProt
- O95793
- Pathways
- Asymmetric Protein Localization
-