RBX1 Antikörper (C-Term)

Produktnummer ABIN3043566

Produktdetails anti-RBX1 Antikörper

Target: RBX1 (Ring-Box 1, E3 Ubiquitin Protein Ligase (RBX1))

Bindungsspezifität: AA 76-108, C-Term

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase RBX1(RBX1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: NHAFHFHCIS RWLKTRQVCP LDNREWEFQK YGH

Kreuzreaktivität (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Produktmerkmale: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase RBX1(RBX1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ring-box 1, E3 ubiquitin protein ligase
Protein Name: E3 ubiquitin-protein ligase RBX1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ROC1 (76-108aa NHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH), identical to the related mouse sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu RBX1

Target: RBX1 (Ring-Box 1, E3 Ubiquitin Protein Ligase (RBX1))

Andere Bezeichnung: RBX1 (RBX1 Produkte)

Synonyme: BA554C12.1 antikoerper, RNF75 antikoerper, ROC1 antikoerper, 1500002P15Rik antikoerper, AA517855 antikoerper, im:7137515 antikoerper, zgc:136444 antikoerper, RBX1 antikoerper, ATRBX1 antikoerper, F7C8.160 antikoerper, F7C8_160 antikoerper, HRT1 antikoerper, REGULATOR OF CULLINS-1 antikoerper, RING-BOX 1 antikoerper, RING-box 1 antikoerper, hop21 antikoerper, BEST:CK01110 antikoerper, CG16982 antikoerper, CK01110 antikoerper, Dmel\CG16982 antikoerper, EG:115C2.11 antikoerper, Rbx1 antikoerper, Rbx1/Roc antikoerper, Roc antikoerper, Roc1alpha antikoerper, anon-EST:Posey65 antikoerper, dRbx1 antikoerper, dRoc1 antikoerper, dRoc1a antikoerper, ring-box 1 antikoerper, ring-box 1, E3 ubiquitin protein ligase antikoerper, RING-box 1 antikoerper, RING-box protein 1 antikoerper, RING-box protein 1a antikoerper, Regulator of cullins 1a antikoerper, RBX1 antikoerper, Rbx1 antikoerper, rbx1 antikoerper, MGG_08844 antikoerper, LOC9308017 antikoerper, rbx-1 antikoerper, Roc1a antikoerper

Hintergrund: RING-box protein 1, also known as ROC1, is a protein that in humans is encoded by the RBX1 gene. This gene is mapped to chromosome 22q13.2 based on an alignment of the RBX1 sequence with the genomic sequence. ROC1 is recruited by cullin-1 to form a quaternary SCF (HOS)-ROC1 holoenzyme (with SKP1 and the BTRCP homolog HOS). SCF (HOS)-ROC1 binds IKK-beta-phosphorylated I-kappa-B-alpha and catalyzes its ubiquitination in the presence of ubiquitin, E1, and CDC34. Conclusively, ROC1 plays a unique role in the ubiquitination reaction by heterodimerizing with cullin-1 to catalyze ubiquitin polymerization.

Synonyms: BA554C12.1 antibody|E3 ubiquitin-protein ligase RBX1 antibody|FLJ60363 antibody|MGC13357 antibody|MGC1481 antibody|OTTHUMP00000028983 antibody|Protein ZYP antibody|Rbx 1 antibody|Rbx1 antibody|RBX1_HUMAN antibody|Regulator of cullins 1 antibody|Ring box 1 antibody| Ring box 1 E3 ubiquitin protein ligase antibody|RING box protein 1 antibody|RING finger protein 75 antibody|RING finger protein antibody|RING-box protein 1 antibody|Ringbox protein 1 antibody|RNF 75 antibody|RNF75 antibody|ROC 1 antibody|ZYP protein antibody

Gen-ID: 9978

UniProt: P62877

Pathways: Zellzyklus, M Phase, SARS-CoV-2 Protein Interaktom