SCARB1 Antikörper (C-Term)
-
- Target Alle SCARB1 Antikörper anzeigen
- SCARB1 (Scavenger Receptor Class B, Member 1 (SCARB1))
-
Bindungsspezifität
- AA 478-509, C-Term
-
Reaktivität
- Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SCARB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Scavenger receptor class B member 1(SCARB1) detection. Tested with WB in Mouse,Rat.
- Sequenz
- KKGSQDKEAI QAYSESLMSP AAKGTVLQEA KL
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Scavenger receptor class B member 1(SCARB1) detection. Tested with WB in Mouse,Rat.
Gene Name: scavenger receptor class B, member 1
Protein Name: Scavenger receptor class B member 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of mouse SCARB1 (478-509aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid.
- Isotyp
- IgG
- Top Product
- Discover our top product SCARB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SCARB1 (Scavenger Receptor Class B, Member 1 (SCARB1))
- Andere Bezeichnung
- SCARB1 (SCARB1 Produkte)
- Synonyme
- cb1015 antikoerper, SCARB1 antikoerper, Scarb1 antikoerper, CD36L1 antikoerper, CLA-1 antikoerper, CLA1 antikoerper, HDLQTL6 antikoerper, SR-BI antikoerper, SRB1 antikoerper, AI120173 antikoerper, CD36 antikoerper, Cd36l1 antikoerper, Cla-1 antikoerper, Cla1 antikoerper, D5Ertd460e antikoerper, Hdlq1 antikoerper, Hlb398 antikoerper, SR-B1 antikoerper, SRBI antikoerper, Srb1 antikoerper, mSR-BI antikoerper, scavenger receptor class B, member 1 antikoerper, scavenger receptor class B member 1 antikoerper, scarb1 antikoerper, SCARB1 antikoerper, Scarb1 antikoerper, CpipJ_CPIJ014332 antikoerper, CpipJ_CPIJ019101 antikoerper
- Hintergrund
-
Scavenger receptor class B member 1 (SRB1), also known as SR-BI, is a protein that in humans is encoded by the SCARB1 gene. SR-BI functions as a receptor for high-density lipoprotein. Scavenger receptor class B, type I (SR-BI) is an integral membrane protein found in numerous cell types/tissues, including the liver and adrenal. It is best known for its role in facilitating the uptake of cholesteryl esters from high-density lipoproteins in the liver. This process drives the movement of cholesterol from peripheral tissues towards the liver for excretion. This movement of cholesterol is known as reverse cholesterol transport and is a protective mechanism against the development of atherosclerosis, which is the principal cause of heart disease and stroke. SR-BI has also been identified in the livers of non-mammalian species (turtle, goldfish, shark, chicken, frog, and skate), suggesting it emerged early in vertebrate evolutionary history. The turtle also seems to upregulate SB-RI during egg development, indicating that cholesterol efflux may be at peak levels during developmental stages.
Synonyms: CD36 AND LIMPII ANALOGOUS 1 antibody|CD36 antibody|CD36 Antigen like 1 antibody|CD36 antigen-like 1 antibody|CD36L1 antibody|CLA 1 antibody|CLA-1 antibody|CLA1 antibody| Collagen type I receptor antibody|HDLQTL6 antibody|MGC138242 antibody|SCARB1 antibody| Scavebger Receptor Class B Member 1 antibody|Scavenger receptor class B member 1 antibody| Scavenger Receptor Class B Type 1 antibody|SCRB1_HUMAN antibody|SR BI antibody|SR-BI antibody|SRB1 antibody|SRBI antibody|Thrombospondin receptor like 1 antibody|thrombospondin receptor-like 1 antibody - Gen-ID
- 20778
- UniProt
- Q61009
- Pathways
- Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Lipid Metabolism, SARS-CoV-2 Protein Interaktom
-