PLA2G4A Antikörper (C-Term)

Produktnummer ABIN3042503

Produktdetails anti-PLA2G4A Antikörper

Target: PLA2G4A (Phospholipase A2, Group IVA (Cytosolic, Calcium-Dependent) (PLA2G4A))

Bindungsspezifität: AA 682-721, C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLA2G4A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Cytosolic phospholipase A2(PLA2G4A) detection. Tested with WB in Human,Mouse.

Sequenz: NFQYPNQAFK RLHDLMHFNT LNNIDVIKEA MVESIEYRRQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Cytosolic phospholipase A2(PLA2G4A) detection. Tested with WB in Human,Mouse.
Gene Name: phospholipase A2, group IVA (cytosolic, calcium-dependent)
Protein Name: Cytosolic phospholipase A2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PLA2G4A (682-721aa NFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQ), different from the related mouse and rat sequences by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu PLA2G4A

Target: PLA2G4A (Phospholipase A2, Group IVA (Cytosolic, Calcium-Dependent) (PLA2G4A))

Andere Bezeichnung: PLA2G4A (PLA2G4A Produkte)

Synonyme: PLA2G4 antikoerper, cPLA2-alpha antikoerper, Pla2c antikoerper, Pla2g4 antikoerper, cPLA2 antikoerper, pla2g4 antikoerper, CPLA2 antikoerper, PLA2G4A antikoerper, PLA2 antikoerper, PLA2G1B antikoerper, cPLA2alpha antikoerper, pla2g4a antikoerper, si:dkey-97o5.1 antikoerper, phospholipase A2 group IVA antikoerper, phospholipase A2 group IVA L homeolog antikoerper, phospholipase A2, group IVA (cytosolic, calcium-dependent) antikoerper, phospholipase A2, group IVAb (cytosolic, calcium-dependent) antikoerper, PLA2G4A antikoerper, Pla2g4a antikoerper, pla2g4a.L antikoerper, pla2g4ab antikoerper

Hintergrund: PLA2G4A (Phospholipase A2, Group IVA), is an enzyme that in humans is encoded by the PLA2G4A gene. Tay et al. (1995) mapped the PLA2G4A gene to rat chromosome 13 by PCR-based intercross genotyping and to human 1q25 by fluorescence in situ hybridization. By site-directed mutagenesis and biochemical analysis of the recombinant protein, Sharp et al. (1994) determined that ser228 participates in the catalytic mechanism of cPLA2 and that both the phospholipase A2 and the lysophospholipase activities are catalyzed by the same active site residue(s). PLA2G4A, the cytosolic phospholipase A2, appears to subserve transmembrane signaling responses to extracellular ligands (Skorecki, 1995).

Synonyms: Calcium dependent phospholipid binding protein antibody|CPLA 2 antibody|cPLA2 alpha antibody|cPLA2 antibody|Cytosolic phospholipase A2 antibody|Cytosolic phospholipase A2 group IVA antibody|Lysophospholipase antibody|MGC126350 antibody|PA24A_HUMAN antibody| Phosphatidylcholine 2 acylhydrolase antibody|Phosphatidylcholine 2-acylhydrolase antibody| Phospholipase A2 group 4 A antibody| Phospholipase A2 group IVA (cytosolic calcium dependent) antibody|Phospholipase A2 group IVA antibody|PhospholipaseA2 antibody|PLA2G4 antibody|pla2g4a antibody

Gen-ID: 5321

UniProt: P47712

Pathways: Inositol Metabolic Process, G-protein mediated Events, VEGF Signaling