Integrin beta 2 Antikörper (N-Term)

Produktnummer ABIN3031373

Produktdetails anti-Integrin beta 2 Antikörper

Target: Integrin beta 2 (ITGB2)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Integrin beta 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: An amino acid sequence from the N-terminus of human CD18 (ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD) was used as the immunogen for this CD18 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: The stated application concentrations are suggested starting amounts. Titration of the CD18 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the CD18 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Integrin beta 2

Target: Integrin beta 2 (ITGB2)

Andere Bezeichnung: CD18 (ITGB2 Produkte)

Synonyme: CD18 antikoerper, LAD antikoerper, LCAMB antikoerper, LFA-1 antikoerper, MAC-1 antikoerper, MF17 antikoerper, MFI7 antikoerper, 2E6 antikoerper, AI528527 antikoerper, Cd18 antikoerper, Lfa1 antikoerper, ITGB2 antikoerper, itgb2 antikoerper, itgb2-a antikoerper, itgb2-b antikoerper, integrin subunit beta 2 antikoerper, integrin beta 2 antikoerper, integrin subunit beta 2 S homeolog antikoerper, ITGB2 antikoerper, Itgb2 antikoerper, itgb2.S antikoerper

Hintergrund: The beta-2 integrin chain gene is designated ITGB2 and the leukocyte antigen has been designated CD18. The 3 alpha integrin chains associated individually with the beta-2 chain as a heterodimer have gene designations of ITGAL, ITGAM, and ITGAX, and leukocyte antigen designations of CD11A, CD11B, and CD11C, respectively. The expression of CD18 was increased in lymphoblastoid cells from persons with Down syndrome, consistent with the location of the gene on chromosome 21. The ITGB2 gene spans approximately 40 kb and contains 16 exons and all exon/intron boundaries conform to the GT/AG splicing consensus. Furthermore, ITGB2 was constitutively clustered. Although it was expressed on the cell surface at normal levels and was capable of function following extracellular stimulation, it could not be activated via the ""inside-out"" signaling pathways.

UniProt: P05107

Pathways: NF-kappaB Signalweg, Activation of Innate immune Response, Toll-Like Receptors Cascades, Activated T Cell Proliferation