BMI1 Antikörper (Middle Region)

Produktnummer ABIN3030170

Produktdetails anti-BMI1 Antikörper

Target: BMI1 (BMI1 Polycomb Ring Finger Oncogene (BMI1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BMI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: An amino acid sequence from the middle region of human Bmi1 (IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR) was used as the immunogen for this Bmi1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: The stated application concentrations are suggested starting amounts. Titration of the Bmi1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Bmi1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu BMI1

Target: BMI1 (BMI1 Polycomb Ring Finger Oncogene (BMI1))

Andere Bezeichnung: Bmi1 (BMI1 Produkte)

Synonyme: FLVI2/BMI1 antikoerper, PCGF4 antikoerper, RNF51 antikoerper, AW546694 antikoerper, Bmi-1 antikoerper, Pcgf4 antikoerper, bmi1 antikoerper, pcgf4 antikoerper, psc1 antikoerper, wu:fb17g03 antikoerper, wu:fd18f06 antikoerper, BMI-1 antikoerper, pcgf4b antikoerper, bmi-1 antikoerper, bmi1-a antikoerper, bmi1-b antikoerper, bmi1b antikoerper, rnf51 antikoerper, xbmi-1 antikoerper, BMI1 proto-oncogene, polycomb ring finger antikoerper, BMI1 polycomb ring finger oncogene antikoerper, Bmi1 polycomb ring finger oncogene antikoerper, bmi1 polycomb ring finger oncogene 1a antikoerper, bmi1 polycomb ring finger oncogene 1b antikoerper, BMI1 proto-oncogene, polycomb ring finger L homeolog antikoerper, BMI1 antikoerper, LOC100230513 antikoerper, Bmi1 antikoerper, bmi1a antikoerper, bmi1b antikoerper, bmi1.L antikoerper

Hintergrund: B lymphoma Mo MLV insertion region 1, also known as RNF51, is a protein which in humans is encoded by the BMI1 gene. The gene is highly conserved in evolution as indicated by zoo blot hybridization with Bmi1 probes corresponding to the protein-encoding domain. By fluorescence in situ hybridization, the human gene is assigned to chromosome 10p13. It has a key role in regulating the proliferative activity of normal stem and progenitor cells. Most importantly, they provided evidence that the proliferative potential of leukemic stem and progenitor cells lacking BMI1 is compromised because they eventually undergo proliferation arrest and show signs of differentiation and apoptosis, leading to transplant failure of the leukemia. Complementation studies showed that the protein completely rescues these proliferative defects. Deletion analysis showed that the RING finger and helix-turn-helix domains of BMI1 were required for life span extension and repression of the tumor suppressor p16(INK4). BMI1 selectively extended the life span of these cultures. Confocal microscopy showed that the protein transiently colocalized with centromeres during interphase in HeLa cells.

Gen-ID: 648

Pathways: Zellzyklus, Autophagie