SLC12A1 Antikörper (AA 52-83)
-
- Target Alle SLC12A1 Antikörper anzeigen
- SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))
-
Bindungsspezifität
- AA 52-83
-
Reaktivität
- Human, Ratte, Maus, Affe
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC12A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Spezifität
- Kidney specific.
- Aufreinigung
- Immunogen affinity purified
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1(52-83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product SLC12A1 Primärantikörper
-
-
- Applikationshinweise
- Approved: IHC, IHC-P (0.1 - 0.5 μg/mL), WB (0.5 - 1 μg/mL)
- Kommentare
-
Target Species of Antibody: Human
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Distilled water
- Konzentration
- Lot specific
- Buffer
- Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- avoid freeze thaw cycles
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
-
- Target
- SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))
- Andere Bezeichnung
- SLC12A1 / NKCC2 (SLC12A1 Produkte)
- Synonyme
- slc12a1 antikoerper, SLC12A1 antikoerper, DKFZp469A2020 antikoerper, BSC1 antikoerper, NKCC2 antikoerper, Nkcc2 antikoerper, AI788571 antikoerper, D630042G03Rik antikoerper, mBSC1 antikoerper, urehr3 antikoerper, si:ch211-220f12.1 antikoerper, solute carrier family 12 member 1 antikoerper, solute carrier family 12, member 1 antikoerper, si:ch211-220f12.1 antikoerper, SLC12A1 antikoerper, Slc12a1 antikoerper
- Hintergrund
-
Name/Gene ID: SLC12A1
Subfamily: Cation:chloride symporter
Family: Transporter
Synonyms: SLC12A1, BSC1, MBSC1, Na-K-2Cl cotransporter, NKCC2A variant A, RBSC, NKCC2 - Gen-ID
- 6557
-