anti-Ratte (Rattus) CSNK1A1 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended CSNK1A1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Casein Kinase 1, alpha 1 (CSNK1A1) Antikörper
  • CK1
  • CK1a
  • CKIa
  • HLCDGP1
  • PRO2975
  • 2610208K14Rik
  • 4632404G05Rik
  • 5430427P18Rik
  • Csnk1a
  • CHUNP6894
  • ck1alpha
  • wu:fb65a02
  • wu:fi30h04
  • wu:fj19c11
  • zgc:92158
  • KER1
  • ck1
  • CKIALPHA
  • CK-II
  • CSNK2A1
  • CG2028
  • CK I
  • CK1alpha
  • CKI
  • CKI alpha
  • CKIalpha
  • CkIa
  • Dmel\\CG2028
  • PKA-C
  • anon-WO03040301.93
  • anon-WO03040301.95
  • ck1a
  • dmCK1
  • dmckI
  • l(1)G0492
  • casein kinase 1 alpha 1
  • casein kinase 1, alpha 1
  • keratin 1
  • casein kinase 1 alpha 1 L homeolog
  • casein kinase 2 alpha 1
  • Casein kinase Ialpha
  • CSNK1A1
  • Csnk1a1
  • csnk1a1
  • KRT1
  • csnk1a1.L
  • CSNK2A1
  • CkIalpha
Epitop
AA 30-68, N-Term
25
21
19
9
7
6
5
5
5
5
5
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
161
89
77
14
13
11
10
10
6
4
4
3
2
2
2
Wirt
Kaninchen
143
17
2
2
2
Klonalität
Polyklonal
Konjugat
Dieser CSNK1A1 Antikörper ist unkonjugiert
8
7
4
4
4
3
1
Applikation
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
162
95
80
31
27
18
12
10
4
3
2
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN3042767
$ 280.00
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
11.117402 ABIN498265 IF IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal 0
7 ABIN272195 IF IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4 ABIN5956200 ELISA IHC (p) WB Rabbit IgG pTyr321 Anmelden zum Anzeigen Polyclonal 0
4 ABIN5956199 ELISA IHC (p) WB Rabbit IgG pTyr294 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2892116 IF IHC IHC (p) WB Rabbit Phe158 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2883636 ELISA IHC IHC (p) WB Rabbit IgG pTyr294 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2892036 IF IHC IHC (p) WB Rabbit Gln317 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2619587 ICC IF IHC IHC (p) WB Rabbit Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN2619586 ICC IF IHC IHC (p) WB Rabbit Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN5956197 ELISA IF IHC (p) WB Rabbit IgG Tyr321 Anmelden zum Anzeigen Polyclonal 0
1 ABIN5956196 ELISA IF IHC (p) WB Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN5956198 ELISA IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5540211 IHC (p) WB Rabbit pTyr294 Anmelden zum Anzeigen Polyclonal 0
1 ABIN5540210 IHC (p) WB Rabbit pTyr294 Anmelden zum Anzeigen Polyclonal 0
1 ABIN4950677 IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0

General

Antigen Casein Kinase 1, alpha 1 (CSNK1A1) Antikörper
Epitop AA 30-68, N-Term
(25), (21), (19), (9), (7), (6), (5), (5), (5), (5), (5), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(161), (89), (77), (14), (13), (11), (10), (10), (6), (4), (4), (3), (2), (2), (2)
Wirt Kaninchen
(143), (17), (2), (2), (2)
Klonalität
Polyklonal
Konjugat Dieser CSNK1A1 Antikörper ist unkonjugiert
(8), (7), (4), (4), (4), (3), (1)
Applikation Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(162), (95), (80), (31), (27), (18), (12), (10), (4), (3), (2), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CSNK1A1 Antikörper

Target Details CSNK1A1 Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Casein kinase I isoform alpha(CSNK1A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Sequenz DIYLAINITN GEEVAVKLES QKARHPQLLY ESKLYKILQ
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Casein kinase I isoform alpha(CSNK1A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: casein kinase 1, alpha 1
Protein Name: Casein kinase I isoform alpha
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ), identical to the related mouse and rat sequences.
Isotyp IgG
Plasmids, Primers & others

Target Details CSNK1A1

Produktdetails anti-CSNK1A1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung CSNK1A1 (CSNK1A1 Antibody Abstract)
Hintergrund Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene.

Synonyms: Casein kinase 1 alpha 1 antibody|Casein kinase I isoform alpha antibody|CK1 antibody|CK1A antibody|CKI alpha antibody|CKI-alpha antibody|CKIa antibody|Clock regulator kinase antibody|Csnk1a1 antibody|Down regulated in lung cancer antibody|HLCDGP1 antibody| KC1A_HUMAN antibody|PRO2975 antibody
Gen-ID 1452
UniProt P48729
Pathways WNT Signalweg, Hedgehog Signalweg

Anwendungsinformationen

Produktdetails anti-CSNK1A1 Antikörper Target Details CSNK1A1 Handhabung Bilder zurück nach oben
Applikations-hinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-CSNK1A1 Antikörper Target Details CSNK1A1 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Bilder

Produktdetails anti-CSNK1A1 Antikörper Target Details CSNK1A1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Casein Kinase 1, alpha 1 (CSNK1A1) (AA 30-68), (N-Term) antibody (ABIN3042767) Anti- CSNK1A1 Picoband antibody,IHC(P) IHC(P): Human Intestinal Cancer Tissue
Western Blotting (WB) image for anti-Casein Kinase 1, alpha 1 (CSNK1A1) (AA 30-68), (N-Term) antibody (ABIN3042767) anti-Casein Kinase 1, alpha 1 (CSNK1A1) (AA 30-68), (N-Term) antibody (Image 2)
Immunohistochemistry (IHC) image for anti-Casein Kinase 1, alpha 1 (CSNK1A1) (AA 30-68), (N-Term) antibody (ABIN3042767) Anti- CSNK1A1 Picoband antibody,IHC(P) IHC(P): Rat Intestine Tissue
Immunohistochemistry (IHC) image for anti-Casein Kinase 1, alpha 1 (CSNK1A1) (AA 30-68), (N-Term) antibody (ABIN3042767) Anti- CSNK1A1 Picoband antibody,IHC(P) IHC(P): Mouse Intestine Tissue