CSNK1A1 Antikörper (N-Term)

Produktnummer ABIN3042767

Produktdetails anti-CSNK1A1 Antikörper

Target: CSNK1A1 (Casein Kinase 1, alpha 1 (CSNK1A1))

Bindungsspezifität: AA 30-68, N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CSNK1A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Casein kinase I isoform alpha(CSNK1A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: DIYLAINITN GEEVAVKLES QKARHPQLLY ESKLYKILQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Casein kinase I isoform alpha(CSNK1A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: casein kinase 1, alpha 1
Protein Name: Casein kinase I isoform alpha

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CSNK1A1

Target: CSNK1A1 (Casein Kinase 1, alpha 1 (CSNK1A1))

Andere Bezeichnung: CSNK1A1 (CSNK1A1 Produkte)

Synonyme: CK1 antikoerper, CK1a antikoerper, CKIa antikoerper, HLCDGP1 antikoerper, PRO2975 antikoerper, 2610208K14Rik antikoerper, 4632404G05Rik antikoerper, 5430427P18Rik antikoerper, Csnk1a antikoerper, CHUNP6894 antikoerper, ck1alpha antikoerper, wu:fb65a02 antikoerper, wu:fi30h04 antikoerper, wu:fj19c11 antikoerper, zgc:92158 antikoerper, KER1 antikoerper, ck1 antikoerper, CKIALPHA antikoerper, CK-II antikoerper, CSNK2A1 antikoerper, CG2028 antikoerper, CK I antikoerper, CK1alpha antikoerper, CKI antikoerper, CKI alpha antikoerper, CKIalpha antikoerper, CkIa antikoerper, Dmel\\CG2028 antikoerper, PKA-C antikoerper, anon-WO03040301.93 antikoerper, anon-WO03040301.95 antikoerper, ck1a antikoerper, dmCK1 antikoerper, dmckI antikoerper, l(1)G0492 antikoerper, casein kinase 1 alpha 1 antikoerper, casein kinase 1, alpha 1 antikoerper, keratin 1 antikoerper, casein kinase 1 alpha 1 L homeolog antikoerper, casein kinase 2 alpha 1 antikoerper, Casein kinase Ialpha antikoerper, CSNK1A1 antikoerper, Csnk1a1 antikoerper, csnk1a1 antikoerper, KRT1 antikoerper, csnk1a1.L antikoerper, CSNK2A1 antikoerper, CkIalpha antikoerper

Hintergrund: Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene.

Synonyms: Casein kinase 1 alpha 1 antibody|Casein kinase I isoform alpha antibody|CK1 antibody|CK1A antibody|CKI alpha antibody|CKI-alpha antibody|CKIa antibody|Clock regulator kinase antibody|Csnk1a1 antibody|Down regulated in lung cancer antibody|HLCDGP1 antibody| KC1A_HUMAN antibody|PRO2975 antibody

Gen-ID: 1452

UniProt: P48729

Pathways: WNT Signalweg, Hedgehog Signalweg