anti-Human UNC93B1 Antikörper für Immunofluorescence

Recommended UNC93B1 Antibody (geliefert von: Anmelden zum Anzeigen )

Unc-93 Homolog B1 (C. Elegans) (UNC93B1) Antikörper
  • UNC93
  • IIAE1
  • UNC93B
  • Unc-93B1
  • Unc93b
  • unc-93 homolog B1, TLR signaling regulator
  • unc-93 homolog B1 (C. elegans)
  • UNC93B1
  • Unc93b1
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN5080438
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2382660 IF IHC ELISA WB Rabbit IgG N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN4364372 ELISA ICC IF IHC IHC (p) WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0


Antigen Unc-93 Homolog B1 (C. Elegans) (UNC93B1) Antikörper
Reaktivität Human
(29), (21), (20), (4), (3), (2), (2), (2), (1)
Wirt Kaninchen
(29), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(28), (12), (11), (10), (2), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-UNC93B1 Antikörper

Target Details UNC93B1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NYITRMAQKYHEYSHYKEQDGQGMKQRPPRGSHAPY
Isotyp IgG
Plasmids, Primers & others

Target Details UNC93B1

Produktdetails anti-UNC93B1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung UNC93B (UNC93B1 Antibody Abstract)
Hintergrund Gene Symbol: UNC93B1
Gen-ID 81622
Pathways TLR Signalweg, Activation of Innate immune Response, Toll-Like Receptors Cascades


Produktdetails anti-UNC93B1 Antikörper Target Details UNC93B1 Handhabung Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-UNC93B1 Antikörper Target Details UNC93B1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-UNC93B1 Antikörper Target Details UNC93B1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Unc-93 Homolog B1 (C. Elegans) (UNC93B1) antibody (ABIN5080438) Western Blot: UNC93B Antibody - Western blot analysis in human cell line RT-4, human...
Immunofluorescence (IF) image for anti-Unc-93 Homolog B1 (C. Elegans) (UNC93B1) antibody (ABIN5080438) Immunocytochemistry/Immunofluorescence: UNC93B Antibody - Staining of human cell lin...