anti-Human Aldehyde Dehydrogenase 1 Family, Member A2 Antikörper für Western Blotting

Recommended Aldehyde Dehydrogenase 1 Family, Member A2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) Antikörper
  • Raldh-2
  • RALDH(II)
  • RALDH2
  • RALDH2-T
  • fb50h01
  • raldh2
  • AV116159
  • Aldh1a7
  • Raldh1
  • Raldh2
  • aldehyde dehydrogenase 1 family, member A2
  • aldehyde dehydrogenase 1 family member A2
  • aldehyde dehydrogenase family 1, subfamily A2
  • Aldh1a2
  • ALDH1A2
  • aldh1a2
Reaktivität
Human
96
74
68
3
3
3
3
3
3
3
1
1
Wirt
Kaninchen
96
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
6
5
4
2
2
2
2
2
2
2
2
2
2
2
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
67
33
27
26
10
3
3
2
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4279209
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
3.0813878 ABIN2788209 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
3.0813878 ABIN2788208 WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
3.0813878 ABIN2704467 IC IF IHC WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
3.0813878 ABIN1535291 ELISA WB Rabbit IgG AA 412-461 Anmelden zum Anzeigen Polyclonal 0
3.0813878 ABIN2856988 WB Rabbit Center Anmelden zum Anzeigen Polyclonal 0
3.0813878 ABIN1866624 ICC IHC WB Rabbit IgG AA 1-422 Anmelden zum Anzeigen Polyclonal 0
3.0813878 ABIN4902887 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
3.0813878 ABIN4279210 WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal 0
3.0813878 ABIN5572376 IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
3.0813878 ABIN3048823 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
3.0813878 ABIN929343 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
3.0813878 ABIN6001644 IF/ICC IHC IP WB Rabbit AA 1-422 Anmelden zum Anzeigen Polyclonal 0
3.0813878 ABIN6136765 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal 0
3.0813878 ABIN2432455 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
3.0813878 ABIN1852014 ELISA WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN611265 WB Rabbit AA 56-105 Anmelden zum Anzeigen Polyclonal 0
1 ABIN702505 IF (p) IHC (p) WB Rabbit IgG AA 485-518 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1493196 WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN3183244 ELISA ICC IHC WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN1833863 WB Rabbit IgG AA 278-518 Anmelden zum Anzeigen Polyclonal 0

General

Antigen Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) Antikörper
Reaktivität Human
(96), (74), (68), (3), (3), (3), (3), (3), (3), (3), (1), (1)
Wirt Kaninchen
(96), (1)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(6), (5), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
(67), (33), (27), (26), (10), (3), (3), (2), (2), (1), (1)
Pubmed 4 Publikationen vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTV
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Antigen
Andere Bezeichnung ALDH1A2 (ALDH1A2 Antibody Abstract)
Hintergrund Gene Symbol: ALDH1A2
Molekulargewicht Theoretical MW: 57 kDa
Gen-ID 8854
UniProt O94788
Pathways Retinoic Acid Receptor Signaling Pathway

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100 - 1:250, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin, HIER pH 6 retrieval is recommended. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen

Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Seidensaal, Nollert, Feige, Muller, Fleming, Gunkel, Zaoui, Grabe, Weichert, Weber, Plinkert, Simon, Hess et al.: "Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell ..." in: Molecular cancer, Vol. 14, pp. 204, 2015 (Probematerial (Species): Human). Weitere Details: Immunohistochemistry

Harper, Wiechmann, Moiseyev, Ma, Summers: "Identification of active retinaldehyde dehydrogenase isoforms in the postnatal human eye." in: PLoS ONE, Vol. 10, Issue 3, pp. e0122008, 2015 (Probematerial (Species): Human). Weitere Details: Western Blotting,Immunohistochemistry

Rizzardi, Rosener, Koopmeiners, Isaksson Vogel, Metzger, Forster, Marston, Tiffany, McCarthy, Turley, Warlick, Henriksen, Schmechel: "Evaluation of protein biomarkers of prostate cancer aggressiveness." in: BMC cancer, Vol. 14, pp. 244, 2014 (Probematerial (Species): Human). Weitere Details: Immunohistochemistry

Kostareli, Holzinger, Bogatyrova, Hielscher, Wichmann, Keck, Lahrmann, Grabe, Flechtenmacher, Schmidt, Seiwert, Dyckhoff, Dietz, Höfler, Pawlita, Benner, Bosch, Plinkert, Plass, Weichenhan, Hess: "HPV-related methylation signature predicts survival in oropharyngeal squamous cell carcinomas." in: The Journal of clinical investigation, Vol. 123, Issue 6, pp. 2488-501, 2013

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) antibody (ABIN4279209) Western Blot: ALDH1A2 Antibody [NBP1-87158] - Lane 1: Marker [kDa] 230, 130, 95, 72, ...
Immunofluorescence (IF) image for anti-Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) antibody (ABIN4279209) Immunocytochemistry/Immunofluorescence: ALDH1A2 Antibody [NBP1-87158] - Staining of h...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) antibody (ABIN4279209) Immunohistochemistry-Paraffin: ALDH1A2 Antibody [NBP1-87158] - Staining of human para...
Simple Western (SimWes) image for anti-Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) antibody (ABIN4279209) Simple Western: ALDH1A2 Antibody [NBP1-87158] - Detection of ALDH1A2 in K562 cells us...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) antibody (ABIN4279209) Immunohistochemistry-Paraffin: ALDH1A2 Antibody - Staining of human skin shows weak ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) antibody (ABIN4279209) Immunohistochemistry-Paraffin: ALDH1A2 Antibody - Staining in human endometrium and ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) antibody (ABIN4279209) Immunohistochemistry-Paraffin: ALDH1A2 Antibody - Staining of human endometrium show...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) antibody (ABIN4279209) Immunohistochemistry-Paraffin: ALDH1A2 Antibody - Staining of human fallopian tube s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) antibody (ABIN4279209) Immunohistochemistry-Paraffin: ALDH1A2 Antibody - Staining of human testis shows mod...
Western Blotting (WB) image for anti-Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) antibody (ABIN4279209) Western Blot: ALDH1A2 Antibody - Analysis in human cell line K562.