CKB Protein (His tag)
-
- Target Alle CKB Proteine anzeigen
- CKB (Creatine Kinase, Brain (CKB))
- Protein-Typ
- Recombinant
-
Spezies
- Pavian
-
Quelle
- Escherichia coli (E. coli)
- Aufreinigungstag / Konjugat
- Dieses CKB Protein ist gelabelt mit His tag.
- Applikation
- Western Blotting (WB), ELISA, Immunogen (Imm)
- Verwendungszweck
- Creatine Kinase BB (CK-BB) Antigen, Recombinant >95%
- Produktmerkmale
- Molecular Weight = 44 kDa. Amino Acid Sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQKHHHHHH.,Purified Recombinant Antigen (His-tag)
- Reinheit
- >95 % by SDS-PAGE
- Top Product
- Discover our top product CKB Protein
-
Creatine Kinase, Brain (CKB) (AA 1-125) protein (His tag)
CKB Spezies: Maus Wirt: Escherichia coli (E. coli) Recombinant Greater than 95 % by SDS-PAGE gel analyses WB, ELISA
Creatine Kinase, Brain (CKB) (AA 1-381) protein (His tag)CKB Spezies: Human Wirt: Escherichia coli (E. coli) Recombinant Greater than 95 % as determined by SDS-PAGE WB, ELISA
Creatine Kinase, Brain (CKB) (AA 1-381) protein (His-IF2DI Tag)CKB Spezies: Human Wirt: Escherichia coli (E. coli) Recombinant Greater than 95 % by SDS-PAGE gel analyses WB, ELISA
Creatine Kinase, Brain (CKB) (AA 1-381) protein (GST tag)CKB Spezies: Human Wirt: Wheat germ Recombinant WB, ELISA, AA, AP
Creatine Kinase, Brain (CKB) (AA 281-381) protein (GST tag)CKB Spezies: Human Wirt: Wheat germ Recombinant WB, ELISA, AA, AP
Creatine Kinase, Brain (CKB) (AA 2-381) protein (His tag)Crystallography grade CKB Spezies: Human Wirt: Insektenzellen Recombinant >95 % as determined by SDS PAGE, Size Exclusion Chromatography and Western Blot. WB, SDS, ELISA, Crys
Creatine Kinase, Brain (CKB) (AA 2-381) protein (His tag)Crystallography grade CKB Spezies: Maus Wirt: Insektenzellen Recombinant >95 % as determined by SDS PAGE, Size Exclusion Chromatography and Western Blot. WB, SDS, ELISA, Crys
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 10 mM Phosphate Buffered Saline, pH 7.4
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
- Short Term (≤ 1 week): 2-8°C. Long Term: ≤ -20°C. Avoid repeated freezing and thawing.
-
- Target
- CKB (Creatine Kinase, Brain (CKB))
- Andere Bezeichnung
- Creatine Kinase BB (CK-BB) (CKB Produkte)
- Synonyme
- B-CK Protein, CKBB Protein, b-ck Protein, ckbb Protein, CKB Protein, Bck Protein, Ck-3 Protein, Ck3 Protein, Ckbb Protein, bck Protein, ckb Protein, cb594 Protein, wu:fj36f10 Protein, wu:fj37d11 Protein, Ckbr Protein, mg:cb02h12 Protein, wu:fb62d04 Protein, wu:fc14g11 Protein, zgc:154095 Protein, zgc:92079 Protein, creatine kinase B Protein, creatine kinase, brain L homeolog Protein, creatine kinase B-type Protein, creatine kinase, brain Protein, creatine kinase, brain b Protein, creatine kinase, brain a Protein, CKB Protein, ckb.L Protein, Ckb Protein, ckb Protein, ckbb Protein, ckba Protein
-
