Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag)

Details zu Produkt Nr. ABIN3077209, Anbieter: Anmelden zum Anzeigen
Proteinname
  • CG12117
  • Dmel\\CG12117
  • SR
  • sptr
  • DDBDRAFT_0188686
  • DDBDRAFT_0191275
  • DDB_0188686
  • DDB_0191275
  • xspr
  • AA409688
  • ENSMUSG00000071345
  • Gm10328
  • SDR38C1
  • NK1R
  • NKIR
  • SPR
  • TAC1R
  • Tac1r
  • Sepiapterin reductase
  • sepiapterin reductase
  • sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)
  • tachykinin receptor 1
  • Sptr
  • sprE
  • CpipJ_CPIJ000511
  • sr
  • spr
  • spre
  • Spr
  • SPR
  • TACR1
  • Tacr1
Proteineigenschaft
AA 1-261
6
2
1
1
1
1
1
Spezies
Human
10
2
1
1
1
1
1
Quelle
Escherichia coli (E. coli)
5
4
2
1
1
Protein-Typ
Recombinant
Aufreinigungstag / Konjugat
His tag
Applikation
Crystallization (Crys), ELISA, SDS-PAGE (SDS), Western Blotting (WB)
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Sequenz MHHHHHHEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK
Sequence including N-terminal His-tag.
Produktmerkmale
  • Made in Germany - from design to production - by highly experienced protein experts.
  • Human SPR Protein (raised in E. Coli) purified by multi-step, protein-specific process to ensure crystallization grade.
  • State-of-the-art algorithm used for plasmid design (Gene synthesis).
Reinigung Two step purification of proteins expressed in bacterial culture:
  1. In a first purification step, the protein is purified from the cleared cell lysate using three different His-tag capture materials: high yield, EDTA resistant, or DTT resistant. Eluate fractions are analyzed by SDS-PAGE.
  2. Protein containing fractions of the best purification are subjected to second purification step through size exclusion chromatography. Eluate fractions are analyzed by SDS-PAGE and Western blot.
Reinheit >95 % as determined by SDS PAGE, Size Exclusion Chromatography and Western Blot.
Sterilität 0.22 μm filtered
Endotoxin-Niveau Endotoxin has not been removed. Please contact us if you require endotoxin removal.
Güteklasse Crystallography grade
Hintergrund Catalyzes the final one or two reductions in tetra-hydrobiopterin biosynthesis to form 5,6,7,8-tetrahydrobiopterin.
Molekulargewicht 29.0 kDa Including tag.
UniProt P35270
Forschungsgebiet Metabolism, Neurology
Pathways Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour, Smooth Muscle Cell Migration
Applikationshinweise In addition to the applications listed above we expect the protein to work for functional studies as well. As the protein has not been tested for functional studies yet we cannot offer a guarantee though.
Kommentare

In cases in which it is highly likely that the recombinant protein with the default tag will be insoluble our protein lab may suggest a higher molecular weight tag (e.g. GST-tag) instead to increase solubility. We will discuss all possible options with you in detail to assure that you receive your protein of interest.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer 100 mM NaCL, 20 mM Hepes, 10% glycerol. pH value is at the discretion of the manufacturer.
Handhabung Avoid repeated freeze-thaw cycles.
Lagerung -80 °C
Informationen zur Lagerung Store at -80°C.
Haltbarkeit Unlimited (if stored properly)
Bilder des Herstellers
 image for Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag) (ABIN3077209) „Crystallography Grade“ protein due to multi-step, protein-specific purification process
 image for Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag) (ABIN3077209) Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag) (Image 2)
 image for Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag) (ABIN3077209) Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag) (Image 3)
Haben Sie etwas anderes gesucht?