anti-Human RPS6KA6 Antikörper für Immunocytochemistry

Recommended RPS6KA6 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 6 (RPS6KA6) Antikörper
  • 2610524K04Rik
  • RSK4
  • PP90RSK4
  • rps6ka6
  • wu:fj94b02
  • zgc:66139
  • ribosomal protein S6 kinase polypeptide 6
  • ribosomal protein S6 kinase A6
  • ribosomal protein S6 kinase a, like
  • Rps6ka6
  • RPS6KA6
  • rps6kal
Reaktivität
Human
55
7
5
5
Wirt
Kaninchen
37
17
2
Klonalität
Polyklonal
Konjugat
Dieser RPS6KA6 Antikörper ist unkonjugiert
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
46
34
23
15
6
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4351291
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN6264872 ELISA ICC IF WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN4351290 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0

General

Antigen Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 6 (RPS6KA6) Antikörper
Reaktivität Human
(55), (7), (5), (5)
Wirt Kaninchen
(37), (17), (2)
Klonalität
Polyklonal
Konjugat Dieser RPS6KA6 Antikörper ist unkonjugiert
(1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(46), (34), (23), (15), (6), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-RPS6KA6 Antikörper

Target Details RPS6KA6 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PFKPASGKPDDTFCFDPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAAQFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSK
Isotyp IgG
Plasmids, Primers & others

Target Details RPS6KA6

Produktdetails anti-RPS6KA6 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung RSK4 (RPS6KA6 Antibody Abstract)
Hintergrund Gene Symbol: RPS6KA6
Gen-ID 27330
Pathways MAPK Signalweg

Anwendungsinformationen

Produktdetails anti-RPS6KA6 Antikörper Target Details RPS6KA6 Handhabung Bilder zurück nach oben
Applikations-hinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50This antibody is useful for Immunohistochemistry-Paraffin. For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-RPS6KA6 Antikörper Target Details RPS6KA6 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-RPS6KA6 Antikörper Target Details RPS6KA6 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 6 (RPS6KA6) antibody (ABIN4351291) Immunohistochemistry-Paraffin: RSK4 Antibody [NBP1-87108] - Staining of human stomach...
Immunofluorescence (IF) image for anti-Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 6 (RPS6KA6) antibody (ABIN4351291) Immunocytochemistry/Immunofluorescence: RSK4 Antibody [NBP1-87108] - Staining of huma...
Immunofluorescence (IF) image for anti-Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 6 (RPS6KA6) antibody (ABIN4351291) Immunocytochemistry/Immunofluorescence: RSK4 Antibody - Immunofluorescent staining o...