anti-Ratte (Rattus) RPS6KA2 Antikörper für Western Blotting

Recommended RPS6KA2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2) Antikörper
  • HU-2
  • MAPKAPK1C
  • RSK
  • RSK3
  • S6K-alpha
  • S6K-alpha2
  • p90-RSK3
  • pp90RSK3
  • 90kDa
  • D17Wsu134e
  • Rps6ka-rs1
  • Rsk3
  • p90rsk
  • pp90rsk
  • ribosomal protein S6 kinase A2
  • ribosomal protein S6 kinase, polypeptide 2
  • Rps6ka2
  • RPS6KA2
Epitop
Middle Region
16
10
9
7
4
4
4
3
3
3
3
3
2
2
2
2
1
1
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
79
72
39
4
4
3
3
3
2
2
1
1
Wirt
Kaninchen
83
13
13
Klonalität
Polyklonal
Konjugat
Dieser RPS6KA2 Antikörper ist unkonjugiert
5
5
5
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
76
61
22
15
13
9
6
4
2
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN634332
$ 473.93
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.755764 ABIN5539580 ELISA WB Goat C-Term Anmelden zum Anzeigen Polyclonal 0
7.8026066 ABIN2559777 ELISA WB Goat IgG C-Term Anmelden zum Anzeigen Polyclonal 0
4.8026066 ABIN2786554 WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 1
4.8026066 ABIN2786553 WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
4.8026066 ABIN2464829 ELISA WB Goat C-Term Anmelden zum Anzeigen Polyclonal 0
4.8026066 ABIN5587212 WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4 ABIN469914 WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN700714 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN745238 IF (p) IHC (p) WB Rabbit IgG pThr353, pThr356 Anmelden zum Anzeigen Polyclonal 0
1 ABIN745253 IF (p) IHC (p) WB Rabbit IgG pThr356, pSer360 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2354178 ELISA WB APC Goat C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2354173 ELISA WB Biotin Goat C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2354174 ELISA WB FITC Goat C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2354176 ELISA WB PE Goat C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2354177 ELISA WB Alkaline Phosphatase (AP) Goat C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2354172 ELISA WB Goat C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN700707 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN700705 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2354175 ELISA WB HRP Goat C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN4952438 ELISA WB Goat Ig Fraction Anmelden zum Anzeigen Polyclonal 0

General

Antigen Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2) Antikörper
Epitop Middle Region
(16), (10), (9), (7), (4), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(79), (72), (39), (4), (4), (3), (3), (3), (2), (2), (1), (1)
Wirt Kaninchen
(83), (13), (13)
Klonalität
Polyklonal
Konjugat Dieser RPS6KA2 Antikörper ist unkonjugiert
(5), (5), (5), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(76), (61), (22), (15), (13), (9), (6), (4), (2), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-RPS6KA2 Antikörper

Target Details RPS6KA2 Anwendungsinformationen Handhabung Bilder
Spezifität RPS6 KA2 antibody was raised against the middle region of RPS6 A2
Reinigung Affinity purified
Immunogen RPS6 KA2 antibody was raised using the middle region of RPS6 A2 corresponding to a region with amino acids LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR
Plasmids, Primers & others

Target Details RPS6KA2

Produktdetails anti-RPS6KA2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung RPS6KA2 (RPS6KA2 Antibody Abstract)
Hintergrund RPS6KA2 is a serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB.
Molekulargewicht 81 kDa (MW of target protein)
Pathways MAPK Signalweg, Neurotrophin Signalübertragung, Regulation of Systemic Arterial Blood Pressure by Hormones, Activation of Innate immune Response, Toll-Like Receptors Cascades

Anwendungsinformationen

Produktdetails anti-RPS6KA2 Antikörper Target Details RPS6KA2 Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

RPS6KA2 Blocking Peptide, catalog no. 33R-5450, is also available for use as a blocking control in assays to test for specificity of this RPS6KA2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-RPS6KA2 Antikörper Target Details RPS6KA2 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 A2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Bilder

Produktdetails anti-RPS6KA2 Antikörper Target Details RPS6KA2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2) (Middle Region) antibody (ABIN634332) RPS6KA2 antibody used at 1 ug/ml to detect target protein.