anti-Human MASP2 Antikörper für Immunofluorescence

Recommended MASP2 Antibody (geliefert von: Anmelden zum Anzeigen )

Mannan-Binding Lectin serine Peptidase 2 (MASP2) Antikörper
  • MAP19
  • MASP-2
  • MASP1P1
  • sMAP
  • MAp19
  • mannan binding lectin serine peptidase 2
  • mannan-binding lectin serine peptidase 2
  • MASP2
  • Masp2
Dieser MASP2 Antikörper ist unkonjugiert
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4892025
Preis und Verfügbarkeit auf Anfrage.


Antigen Mannan-Binding Lectin serine Peptidase 2 (MASP2) Antikörper
Epitop N-Term
(15), (6), (4), (4), (4), (4), (3), (3), (2), (2), (2), (1), (1), (1)
Reaktivität Human
(58), (24), (17), (3), (2), (2), (2), (1), (1), (1), (1)
Wirt Kaninchen
(55), (4)
Konjugat Dieser MASP2 Antikörper ist unkonjugiert
(6), (5), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(46), (24), (13), (8), (7), (6), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-MASP2 Antikörper

Target Details MASP2 Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen Synthetic peptides corresponding to MASP2(mannan-binding lectin serine peptidase 2) The peptide sequence was selected from the N terminal of MASP2. Peptide sequence FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK.

Target Details MASP2

Produktdetails anti-MASP2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung MASP2 (MASP2 Antibody Abstract)
Hintergrund Gene Symbol: MASP2
Molekulargewicht Theoretical MW: 27 kDa
Gen-ID 10747
UniProt O00187
Pathways Komplementsystem


Produktdetails anti-MASP2 Antikörper Target Details MASP2 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 0.2-1 μg/mL, Immunocytochemistry/Immunofluorescence 1:10-1:500This is a rabbit polyclonal antibody against MASP2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-MASP2 Antikörper Target Details MASP2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.


Produktdetails anti-MASP2 Antikörper Target Details MASP2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Mannan-Binding Lectin serine Peptidase 2 (MASP2) (N-Term) antibody (ABIN4892025) Western Blot: MASP2 Antibody [NBP1-58986] - Antibody Titration: 0.2-1 ug/ml ELISA Tit...
Immunofluorescence (IF) image for anti-Mannan-Binding Lectin serine Peptidase 2 (MASP2) (N-Term) antibody (ABIN4892025) Immunocytochemistry/Immunofluorescence: MASP2 Antibody [NBP1-58986] - Formalin Fixed ...