anti-Hund Arginase, Liver Antikörper für Western Blotting

Recommended Arginase, Liver Antibody (geliefert von: Anmelden zum Anzeigen )

Arginase, Liver (ARG1) Antikörper
  • SI:zC146F4.4 (novel protein with NUDIX domain)
  • si:ch211-146f4.3
  • argi1
  • AI
  • AI256583
  • Arg-1
  • PGIF
  • arginase 1
  • arginase
  • Arginase-1
  • arginase, liver
  • L-arginase
  • arg1
  • PGTG_16455
  • argi1
  • ARG1
  • Arg1
Arg1, N-Term
Human, Ratte (Rattus), Hund
Immunohistochemistry (IHC), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN629657
$ 437.50
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
3.3284883 ABIN2462877 IHC ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal
3.3284883 ABIN2462876 IHC ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal
3.3284883 ABIN629658 IHC WB Rabbit Arg1, C-Term Anmelden zum Anzeigen Polyclonal
3.3284883 ABIN2561197 ELISA WB Goat IgG C-Term Anmelden zum Anzeigen Polyclonal
3.3284883 ABIN2560849 ELISA WB Goat IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2782309 IHC WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 1
1 ABIN2773866 IHC WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 2
1 ABIN2782310 IHC WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 1
1 ABIN320968 IHC (p) WB Rabbit IgG AA 101-150 Anmelden zum Anzeigen Polyclonal
1 ABIN320969 IHC (p) WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN295463 ELISA WB Goat AA 316-330 Anmelden zum Anzeigen Polyclonal
1 ABIN604747 IHC (p) WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal
1 ABIN5553324 WB Goat Arg1, C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN5553588 WB Goat C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN1731932 IHC (p) ELISA WB Goat C-Term, Arg1 Anmelden zum Anzeigen Polyclonal


Antigen Arginase, Liver (ARG1) Antikörper
Epitop Arg1, N-Term
(70), (42), (18), (17), (9), (7), (7), (7), (5), (5), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Human, Ratte (Rattus), Hund
(194), (78), (70), (24), (15), (14), (8), (5), (3), (3), (2), (2), (2), (1)
Wirt Kaninchen
(156), (48), (42), (10), (4)
Konjugat Unkonjugiert
(13), (13), (10), (10), (8), (7), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Western Blotting (WB)
(201), (119), (44), (43), (36), (22), (21), (13), (5), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Arginase 1 antibody was raised against the N terminal of ARG1
Reinigung Purified
Immunogen Arginase 1 antibody was raised using the N terminal of ARG1 corresponding to a region with amino acids HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung Arginase 1 (ARG1 Antibody Abstract)
Hintergrund Arginase catalyzes the hydrolysis of arginine to ornithine and urea. The type I isoform of ARG1, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.
Molekulargewicht 35 kDa (MW of target protein)
Forschungsgebiet Proteases, Enzymes
Pathways Cellular Response to Molecule of Bacterial Origin


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Arginase 1 Blocking Peptide, catalog no. 33R-3855, is also available for use as a blocking control in assays to test for specificity of this Arginase 1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARG1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Arginase, Liver (ARG1) (Arg1), (N-Term) antibody (ABIN629657) Arginase 1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml...
Immunohistochemistry (IHC) image for anti-Arginase, Liver (ARG1) (Arg1), (N-Term) antibody (ABIN629657) Arginase 1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml...
Western Blotting (WB) image for anti-Arginase, Liver (ARG1) (Arg1), (N-Term) antibody (ABIN629657) Arginase 1 antibody used at 5 ug/ml to detect target protein.