anti-Human BID Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended BID Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
BH3 Interacting Domain Death Agonist (BID) Antikörper
  • FP497
  • 2700049M22Rik
  • AI875481
  • AU022477
  • BID
  • bid
  • si:ch211-238n5.6
  • fp497
  • xbid
  • DKFZp469E066
  • BH3 interacting domain death agonist
  • BH3 interacting domain death agonist S homeolog
  • BID
  • Bid
  • bida
  • bid.S
  • bid
Reaktivität
Human
336
175
77
9
5
3
2
Wirt
Kaninchen
308
100
21
9
Klonalität
Polyklonal
Konjugat
Dieser BID Antikörper ist unkonjugiert
24
22
14
9
8
7
4
4
3
3
3
3
3
3
3
3
3
2
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
368
191
167
93
54
41
38
25
16
15
11
11
3
2
1
1
1
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4284621
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
10.927919 ABIN5945353 FACS ICC IF IHC IHC (p) IP WB Rabbit IgG Anmelden zum Anzeigen JM11-14 0
10.927919 ABIN4284618 IHC IHC (p) IP WB Rabbit Anmelden zum Anzeigen Polyclonal 1
10.927919 ABIN4284613 IHC IHC (fro) IHC (p) IP WB Rabbit Anmelden zum Anzeigen Polyclonal 1
10.927919 ABIN4284615 IHC IHC (fro) IHC (p) IP WB Rabbit Anmelden zum Anzeigen Polyclonal 4
10.927919 ABIN153045 IHC (p) IHC WB Rabbit AA 60-120 Anmelden zum Anzeigen Polyclonal 2
10.927919 ABIN738441 IF (p) IHC (p) Rabbit IgG AA 142-192 Anmelden zum Anzeigen Polyclonal 1
10.927919 ABIN343922 ELISA IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
10.927919 ABIN121851 IHC (p) WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
10.927919 ABIN4284620 ELISA IF IHC IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal 0
10.927919 ABIN4906603 IF IHC (p) WB Mouse IgG1 kappa Anmelden zum Anzeigen 1519CT649-18-47 0
1 ABIN388099 IHC (p) WB Rabbit Ig Fraction AA 68-103, BH3 Domain Anmelden zum Anzeigen Polyclonal 3
1 ABIN3042321 ICC IHC (p) WB Rabbit IgG AA 1-195 Anmelden zum Anzeigen Polyclonal 0
1 ABIN358089 EIA IHC (p) WB Rabbit Ig Fraction pSer65 Anmelden zum Anzeigen Polyclonal 5
1 ABIN389523 IHC (p) WB Rabbit Ig Fraction pSer65 Anmelden zum Anzeigen Polyclonal 5
1 ABIN356816 EIA IHC (p) WB Rabbit Ig Fraction BH3 Domain Anmelden zum Anzeigen Polyclonal 4
1 ABIN957168 IHC IHC (fro) IHC (p) IP WB Rabbit AA 28-50 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2888649 ELISA IHC IHC (p) WB Rabbit IgG AA 44-93 Anmelden zum Anzeigen Polyclonal 0
1 ABIN127033 IHC (p) IP WB Rabbit Anmelden zum Anzeigen Polyclonal 0
1 ABIN573988 IHC IHC (p) WB Rat IgG1 Anmelden zum Anzeigen 1H11 0
1 ABIN957167 IHC IHC (fro) IHC (p) IP WB Rabbit AA 1-55 Anmelden zum Anzeigen Polyclonal 0

General

Antigen BH3 Interacting Domain Death Agonist (BID) Antikörper
Reaktivität Human
(336), (175), (77), (9), (5), (3), (2)
Wirt Kaninchen
(308), (100), (21), (9)
Klonalität
Polyklonal
Konjugat Dieser BID Antikörper ist unkonjugiert
(24), (22), (14), (9), (8), (7), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(368), (191), (167), (93), (54), (41), (38), (25), (16), (15), (11), (11), (3), (2), (1), (1), (1), (1), (1), (1)
Pubmed 3 Publikationen vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-BID Antikörper

Target Details BID Anwendungsinformationen Handhabung Referenzen für anti-BID Antikörper (ABIN4284621) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTT
Isotyp IgG
Plasmids, Primers & others

Target Details BID

Produktdetails anti-BID Antikörper Anwendungsinformationen Handhabung Referenzen für anti-BID Antikörper (ABIN4284621) Bilder zurück nach oben
Antigen
Andere Bezeichnung BID (BID Antibody Abstract)
Hintergrund Gene Symbol: BID
Gen-ID 637
Pathways Apoptose, Caspase Kaskade in der Apoptose, Positive Regulation of Endopeptidase Activity

Anwendungsinformationen

Produktdetails anti-BID Antikörper Target Details BID Handhabung Referenzen für anti-BID Antikörper (ABIN4284621) Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-BID Antikörper Target Details BID Anwendungsinformationen Referenzen für anti-BID Antikörper (ABIN4284621) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-BID Antikörper (ABIN4284621)

Produktdetails anti-BID Antikörper Target Details BID Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Gaudet, Spencer, Chen, Sorger: "Exploring the contextual sensitivity of factors that determine cell-to-cell variability in receptor-mediated apoptosis." in: PLoS computational biology, Vol. 8, Issue 4, pp. e1002482, 2012

Aldridge, Gaudet, Lauffenburger, Sorger: "Lyapunov exponents and phase diagrams reveal multi-factorial control over TRAIL-induced apoptosis." in: Molecular systems biology, Vol. 7, pp. 553, 2011

Spencer, Gaudet, Albeck, Burke, Sorger: "Non-genetic origins of cell-to-cell variability in TRAIL-induced apoptosis." in: Nature, Vol. 459, Issue 7245, pp. 428-32, 2009

Bilder

Produktdetails anti-BID Antikörper Target Details BID Anwendungsinformationen Handhabung Referenzen für anti-BID Antikörper (ABIN4284621) zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-BH3 Interacting Domain Death Agonist (BID) antibody (ABIN4284621) Immunohistochemistry-Paraffin: BID Antibody [NBP1-86187] - Bid Antibody [NBP1-86187] ...
Western Blotting (WB) image for anti-BH3 Interacting Domain Death Agonist (BID) antibody (ABIN4284621) Western Blot: Bid Antibody [NBP1-86187] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, ...
Immunofluorescence (IF) image for anti-BH3 Interacting Domain Death Agonist (BID) antibody (ABIN4284621) Immunocytochemistry/Immunofluorescence: BID Antibody - Immunofluorescent staining of...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-BH3 Interacting Domain Death Agonist (BID) antibody (ABIN4284621) Immunohistochemistry-Paraffin: BID Antibody - Staining of human testis shows low exp...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-BH3 Interacting Domain Death Agonist (BID) antibody (ABIN4284621) Immunohistochemistry-Paraffin: BID Antibody - Staining in human bone marrow and test...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-BH3 Interacting Domain Death Agonist (BID) antibody (ABIN4284621) Immunohistochemistry-Paraffin: BID Antibody - Staining of human bone marrow shows hi...
Western Blotting (WB) image for anti-BH3 Interacting Domain Death Agonist (BID) antibody (ABIN4284621) Western Blot: BID Antibody - Analysis in human cell lines MCF-7 and HeLa. Correspond...