IL13RA2 Antikörper (Middle Region)
-
- Target Alle IL13RA2 Antikörper anzeigen
- IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IL13RA2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IL13 RA2 antibody was raised against the middle region of IL13 A2
- Aufreinigung
- Affinity purified
- Immunogen
- IL13 RA2 antibody was raised using the middle region of IL13 A2 corresponding to a region with amino acids GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP
- Top Product
- Discover our top product IL13RA2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IL13RA2 Blocking Peptide, catalog no. 33R-3505, is also available for use as a blocking control in assays to test for specificity of this IL13RA2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))
- Andere Bezeichnung
- IL13RA2 (IL13RA2 Produkte)
- Synonyme
- il-13ra2 antikoerper, sb:cb602 antikoerper, si:dkeyp-110c7.6 antikoerper, CD213A2 antikoerper, CT19 antikoerper, IL-13R antikoerper, IL13BP antikoerper, CD213a2 antikoerper, IL-13R-alpha-2 antikoerper, IL13RA2 antikoerper, interleukin 13 receptor, alpha 2 antikoerper, interleukin 13 receptor subunit alpha 2 antikoerper, interleukin 13 receptor subunit alpha 2 S homeolog antikoerper, il13ra2 antikoerper, IL13RA2 antikoerper, il13ra2.S antikoerper, Il13ra2 antikoerper
- Hintergrund
- IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.
- Molekulargewicht
- 42 kDa (MW of target protein)
-