IL13RA2 Antikörper (Middle Region)

Produktnummer ABIN636087

Der Kaninchen Polyklonal anti-IL13RA2 Antikörper (ABIN636087) detektiert spezifisch IL13RA2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für IL13RA2 Antikörper (Middle Region) (ABIN636087)

Target: IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL13RA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IL13RA2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: IL13 RA2 antibody was raised against the middle region of IL13 A2

Aufreinigung: Affinity purified

Immunogen: IL13 RA2 antibody was raised using the middle region of IL13 A2 corresponding to a region with amino acids GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL13RA2 Blocking Peptide, (ABIN938891), is also available for use as a blocking control in assays to test for specificity of this IL13RA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL13RA2

Target: IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))

Andere Bezeichnung: IL13RA2

Hintergrund: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.

Molekulargewicht: 42 kDa (MW of target protein)