CYP2E1 Antikörper (C-Term)

Produktnummer ABIN636072

Produktdetails anti-CYP2E1 Antikörper

Target: CYP2E1 (Cytochrome P450, Family 2, Subfamily E, Polypeptide 1 (CYP2E1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP2E1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP2 E1 antibody was raised against the C terminal of CYP2 1

Aufreinigung: Affinity purified

Immunogen: CYP2 E1 antibody was raised using the C terminal of CYP2 1 corresponding to a region with amino acids QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP2E1 Blocking Peptide, catalog no. 33R-7522, is also available for use as a blocking control in assays to test for specificity of this CYP2E1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP2E1

Target: CYP2E1 (Cytochrome P450, Family 2, Subfamily E, Polypeptide 1 (CYP2E1))

Andere Bezeichnung: CYP2E1 (CYP2E1 Produkte)

Synonyme: CYP2E1 antikoerper, CYP2E antikoerper, CYPIIE1 antikoerper, CPE1 antikoerper, P450-J antikoerper, P450C2E antikoerper, Cyp2e antikoerper, cytochrome P450, family 2, subfamily E, polypeptide 1 antikoerper, cytochrome P450 2E1 antikoerper, cytochrome P450 2E1-like antikoerper, cytochrome P450 family 2 subfamily E member 1 antikoerper, cytochrome P450, family 2, subfamily e, polypeptide 1 antikoerper, CYP2E1 antikoerper, PTRG_07411 antikoerper, LOC100342572 antikoerper, LOC100727914 antikoerper, LOC101843716 antikoerper, Cyp2e1 antikoerper

Hintergrund: CYP2E1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation.

Molekulargewicht: 54 kDa (MW of target protein)