CYP3A7 Antikörper (Middle Region)

Produktnummer ABIN636069

Produktdetails anti-CYP3A7 Antikörper

Target: CYP3A7 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 7 (CYP3A7))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP3A7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP3 A7 antibody was raised against the middle region of CYP3 7

Aufreinigung: Affinity purified

Immunogen: CYP3 A7 antibody was raised using the middle region of CYP3 7 corresponding to a region with amino acids KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP3A7 Blocking Peptide, catalog no. 33R-4501, is also available for use as a blocking control in assays to test for specificity of this CYP3A7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP3A7

Target: CYP3A7 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 7 (CYP3A7))

Andere Bezeichnung: CYP3A7 (CYP3A7 Produkte)

Synonyme: CP37 antikoerper, CYPIIIA7 antikoerper, P450-HFLA antikoerper, cytochrome P450, family 3, subfamily A, polypeptide 7 antikoerper, cytochrome P450 family 3 subfamily A member 7 antikoerper, CYP3A7 antikoerper

Hintergrund: CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis