ACVR1C/ALK7 Antikörper (N-Term)
-
- Target Alle ACVR1C/ALK7 (ACVR1C) Antikörper anzeigen
- ACVR1C/ALK7 (ACVR1C) (Activin Receptor Type 1C (ACVR1C))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACVR1C/ALK7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACVR1 C antibody was raised against the N terminal of ACVR1
- Aufreinigung
- Affinity purified
- Immunogen
- ACVR1 C antibody was raised using the N terminal of ACVR1 corresponding to a region with amino acids QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP
- Top Product
- Discover our top product ACVR1C Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACVR1C Blocking Peptide, catalog no. 33R-7772, is also available for use as a blocking control in assays to test for specificity of this ACVR1C antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACVR0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACVR1C/ALK7 (ACVR1C) (Activin Receptor Type 1C (ACVR1C))
- Andere Bezeichnung
- ACVR1C (ACVR1C Produkte)
- Synonyme
- ACVRLK7 antikoerper, ALK7 antikoerper, Alk-7 antikoerper, C230097P10 antikoerper, Alk7 antikoerper, habrec1 antikoerper, activin A receptor type 1C antikoerper, activin A receptor, type IC antikoerper, ACVR1C antikoerper, Acvr1c antikoerper
- Hintergrund
- ACVR1C is a type I receptor for the TGFB family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors.
- Molekulargewicht
- 55 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion, Positive Regulation of Endopeptidase Activity
-