ST6GALNAC1 Antikörper
-
- Target Alle ST6GALNAC1 Antikörper anzeigen
- ST6GALNAC1 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 1 (ST6GALNAC1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ST6GALNAC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ST6 GALNAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKNVPLGKDVRYLHFL
- Top Product
- Discover our top product ST6GALNAC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ST6GALNAC1 Blocking Peptide, catalog no. 33R-5049, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ST6GALNAC1 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 1 (ST6GALNAC1))
- Andere Bezeichnung
- ST6GALNAC1 (ST6GALNAC1 Produkte)
- Synonyme
- HSY11339 antikoerper, SIAT7A antikoerper, ST6GalNAcI antikoerper, STYI antikoerper, Siat7a antikoerper, Siat7A antikoerper, ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 antikoerper, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 antikoerper, ST6GALNAC1 antikoerper, St6galnac1 antikoerper
- Hintergrund
- Glycosylation of proteins affects cell-cell interaction, interactions with the matrix, and the functions of intracellular molecules. ST6GALNAC1 transfers a sialic acid, N-acetylneuraminic acid (NeuAc), in an alpha-2,6 linkage to O-linked GalNAc residues. The cancer-associated sialyl-Tn (sTn) antigen is formed by ST6GALNAC1-catalyzed sialylation of GalNAc residues on mucins.
- Molekulargewicht
- 68 kDa (MW of target protein)
-