ACE2 Antikörper

Produktnummer ABIN636042

Produktdetails anti-ACE2 Antikörper

Target: ACE2 (Angiotensin I Converting Enzyme 2 (ACE2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACE2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ACE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACE2 Blocking Peptide, catalog no. 33R-3121, is also available for use as a blocking control in assays to test for specificity of this ACE2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACE2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACE2

Target: ACE2 (Angiotensin I Converting Enzyme 2 (ACE2))

Andere Bezeichnung: ACE2 (ACE2 Produkte)

Synonyme: ACE1 antikoerper, CD143 antikoerper, DCP antikoerper, DCP1 antikoerper, ICH antikoerper, MVCD3 antikoerper, ACEH antikoerper, 2010305L05Rik antikoerper, zgc:92514 antikoerper, angiotensin I converting enzyme antikoerper, angiotensin I converting enzyme 2 antikoerper, angiotensin I converting enzyme (peptidyl-dipeptidase A) 2 antikoerper, ACE antikoerper, ACE2 antikoerper, Ace2 antikoerper, ace2 antikoerper

Hintergrund: ACE2 belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this geneuggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63.

Molekulargewicht: 89 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour