HSD11B1 Antikörper

Produktnummer ABIN636041

Produktdetails anti-HSD11B1 Antikörper

Target: HSD11B1 (Hydroxysteroid (11-Beta) Dehydrogenase 1 (HSD11B1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSD11B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: HSD11 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSD11B1 Blocking Peptide, catalog no. 33R-7614, is also available for use as a blocking control in assays to test for specificity of this HSD11B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSD11B1

Target: HSD11B1 (Hydroxysteroid (11-Beta) Dehydrogenase 1 (HSD11B1))

Andere Bezeichnung: HSD11B1 (HSD11B1 Produkte)

Synonyme: 11-DH antikoerper, 11-beta-HSD1 antikoerper, CORTRD2 antikoerper, HDL antikoerper, HSD11 antikoerper, HSD11B antikoerper, HSD11L antikoerper, SDR26C1 antikoerper, hsd11 antikoerper, hsd11b antikoerper, LRRGT00065 antikoerper, hydroxysteroid 11-beta dehydrogenase 1 antikoerper, hydroxysteroid (11-beta) dehydrogenase 1b antikoerper, hydroxysteroid (11-beta) dehydrogenase 1 L homeolog antikoerper, HSD11B1 antikoerper, HSD11B1b antikoerper, hsd11b1.L antikoerper, Hsd11b1 antikoerper

Hintergrund: HSD11B1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, HSD11B1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children.

Molekulargewicht: 32 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Regulation of Carbohydrate Metabolic Process