IL28RA Antikörper
-
- Target Alle IL28RA Antikörper anzeigen
- IL28RA (Interleukin 28 Receptor, alpha (Interferon, lambda Receptor) (IL28RA))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IL28RA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- IL28 R alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF
- Top Product
- Discover our top product IL28RA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IL28R alpha Blocking Peptide, catalog no. 33R-2338, is also available for use as a blocking control in assays to test for specificity of this IL28R alpha antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL20 A antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL28RA (Interleukin 28 Receptor, alpha (Interferon, lambda Receptor) (IL28RA))
- Andere Bezeichnung
- IL28R alpha (IL28RA Produkte)
- Synonyme
- IFNLR1 antikoerper, IL28RA antikoerper, crf2/12 antikoerper, ifnlr antikoerper, il-28r1 antikoerper, il28ra antikoerper, licr2 antikoerper, ifnlr1 antikoerper, CRF2-12 antikoerper, Il28ra antikoerper, CRF2/12 antikoerper, IFNLR antikoerper, IL-28R1 antikoerper, LICR2 antikoerper, RGD1562689 antikoerper, interferon lambda receptor 1 antikoerper, interferon, lambda receptor 1 antikoerper, interferon, lambda receptor 1 L homeolog antikoerper, IFNLR1 antikoerper, ifnlr1 antikoerper, ifnlr1.L antikoerper, Ifnlr1 antikoerper
- Hintergrund
- IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B.
- Molekulargewicht
- 54 kDa (MW of target protein)
-