CX3CL1 Antikörper

Produktnummer ABIN635921

Produktdetails anti-CX3CL1 Antikörper

Target: CX3CL1 (Chemokine (C-X3-C Motif) Ligand 1 (CX3CL1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CX3CL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ABCD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABCD3 Blocking Peptide, catalog no. 33R-5113, is also available for use as a blocking control in assays to test for specificity of this ABCD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CX3CL1

Target: CX3CL1 (Chemokine (C-X3-C Motif) Ligand 1 (CX3CL1))

Andere Bezeichnung: ABCD3 (CX3CL1 Produkte)

Synonyme: ABCD3 antikoerper, CX3CL1 antikoerper, DKFZp459K117 antikoerper, Cx3c antikoerper, Scyd1 antikoerper, ABCD-3 antikoerper, C3Xkine antikoerper, CXC3 antikoerper, CXC3C antikoerper, NTN antikoerper, NTT antikoerper, SCYD1 antikoerper, fractalkine antikoerper, neurotactin antikoerper, AB030188 antikoerper, AI848747 antikoerper, CX3C antikoerper, Cxc3 antikoerper, D8Bwg0439e antikoerper, ATP binding cassette subfamily D member 3 antikoerper, C-X3-C motif chemokine ligand 1 antikoerper, chemokine (C-X3-C motif) ligand 1 antikoerper, ABCD3 antikoerper, CX3CL1 antikoerper, Cx3cl1 antikoerper, Abcd3 antikoerper

Hintergrund: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.

Molekulargewicht: 75 kDa (MW of target protein)

Pathways: Synaptic Membrane