PERP Antikörper (Middle Region)

Produktnummer ABIN635864

Produktdetails anti-PERP Antikörper

Target: PERP (TP53 Apoptosis Effector (PERP))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PERP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PERP antibody was raised against the middle region of PERP

Aufreinigung: Affinity purified

Immunogen: PERP antibody was raised using the middle region of PERP corresponding to a region with amino acids FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PERP Blocking Peptide, catalog no. 33R-2984, is also available for use as a blocking control in assays to test for specificity of this PERP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PERP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PERP

Target: PERP (TP53 Apoptosis Effector (PERP))

Andere Bezeichnung: PERP (PERP Produkte)

Synonyme: KCP1 antikoerper, KRTCAP1 antikoerper, PIGPC1 antikoerper, RP3-496H19.1 antikoerper, THW antikoerper, dJ496H19.1 antikoerper, 1110017A08Rik antikoerper, kcp1 antikoerper, krtcap1 antikoerper, pigpc1 antikoerper, thw antikoerper, fk24g11 antikoerper, wu:fk24g11 antikoerper, PERP antikoerper, PERP, TP53 apoptosis effector antikoerper, PERP, TP53 apoptosis effector S homeolog antikoerper, PERP antikoerper, Perp antikoerper, perp.S antikoerper, perp antikoerper

Hintergrund: PERP is a component of intercellular desmosome junctions. PERP plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. PERP also plays a role as an effector in the TP53-dependent apoptotic pathway.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Positive Regulation of Endopeptidase Activity