CA4 Antikörper (C-Term)
-
- Target Alle CA4 Antikörper anzeigen
- CA4 (Carbonic Anhydrase IV (CA4))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CA4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Carbonic Anhydrase IV antibody was raised against the C terminal of CA4
- Aufreinigung
- Affinity purified
- Immunogen
- Carbonic Anhydrase IV antibody was raised using the C terminal of CA4 corresponding to a region with amino acids AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
- Top Product
- Discover our top product CA4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Carbonic Anhydrase IV Blocking Peptide, catalog no. 33R-1176, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase IV antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CA4 (Carbonic Anhydrase IV (CA4))
- Andere Bezeichnung
- Carbonic Anhydrase IV (CA4 Produkte)
- Synonyme
- CAIV antikoerper, Car4 antikoerper, RP17 antikoerper, AW456718 antikoerper, Ca4 antikoerper, ca4 antikoerper, caiv antikoerper, car4 antikoerper, rp17 antikoerper, CA4 antikoerper, zgc:171842 antikoerper, carbonic anhydrase 4 antikoerper, carbonic anhydrase 4 S homeolog antikoerper, carbonic anhydrase IV a antikoerper, CA4 antikoerper, Car4 antikoerper, ca4 antikoerper, ca4.S antikoerper, Ca4 antikoerper, ca4a antikoerper
- Hintergrund
- Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known.
- Molekulargewicht
- 34 kDa (MW of target protein)
-