CA4 Antikörper (C-Term)

Produktnummer ABIN635852

Der Kaninchen Polyklonal anti-CA4 Antikörper wird verwendet zum Nachweis von CA4 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für CA4 Antikörper (C-Term) (ABIN635852)

Target: CA4 (Carbonic Anhydrase IV (CA4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CA4 Antikörper

Bindungsspezifität: C-Term

Spezifität: Carbonic Anhydrase IV antibody was raised against the C terminal of CA4

Aufreinigung: Affinity purified

Immunogen: Carbonic Anhydrase IV antibody was raised using the C terminal of CA4 corresponding to a region with amino acids AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carbonic Anhydrase IV Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase IV antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CA4

Target: CA4 (Carbonic Anhydrase IV (CA4))

Andere Bezeichnung: Carbonic Anhydrase IV

Hintergrund: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known.

Molekulargewicht: 34 kDa (MW of target protein)