FZD5 Antikörper

Produktnummer ABIN635844

Produktdetails anti-FZD5 Antikörper

Target: FZD5 (Frizzled Family Receptor 5 (FZD5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FZD5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: FZD5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSH

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FZD5 Blocking Peptide, catalog no. 33R-8742, is also available for use as a blocking control in assays to test for specificity of this FZD5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FZD5

Target: FZD5 (Frizzled Family Receptor 5 (FZD5))

Andere Bezeichnung: FZD5 (FZD5 Produkte)

Synonyme: C2orf31 antikoerper, HFZ5 antikoerper, 5330434N09Rik antikoerper, AI427138 antikoerper, Fz-5 antikoerper, Fz5 antikoerper, mFz5 antikoerper, Xfz5 antikoerper, frizzled5 antikoerper, frizzled5a antikoerper, fz5 antikoerper, fzd5-A antikoerper, fz2 antikoerper, fz8c antikoerper, fzd8c antikoerper, zg02 antikoerper, frizzled class receptor 5 antikoerper, frizzled class receptor 5 S homeolog antikoerper, FZD5 antikoerper, Fzd5 antikoerper, fzd5.S antikoerper, fzd5 antikoerper

Hintergrund: Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.

Molekulargewicht: 64 kDa (MW of target protein)

Pathways: WNT Signalweg