CYP1A1 Antikörper (Middle Region)
-
- Target Alle CYP1A1 Antikörper anzeigen
- CYP1A1 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 1 (CYP1A1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CYP1A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CYP1 A1 antibody was raised against the middle region of CYP1 1
- Aufreinigung
- Affinity purified
- Immunogen
- CYP1 A1 antibody was raised using the middle region of CYP1 1 corresponding to a region with amino acids QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV
- Top Product
- Discover our top product CYP1A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CYP1A1 Blocking Peptide, catalog no. 33R-7644, is also available for use as a blocking control in assays to test for specificity of this CYP1A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP1A1 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 1 (CYP1A1))
- Andere Bezeichnung
- CYP1A1 (CYP1A1 Produkte)
- Synonyme
- AHH antikoerper, AHRR antikoerper, CP11 antikoerper, CYP1 antikoerper, P1-450 antikoerper, P450-C antikoerper, P450DX antikoerper, Cyp1a2 antikoerper, P450-1 antikoerper, cyp1a1 antikoerper, CYP1A1 antikoerper, CYPIA1 antikoerper, Cyp45c antikoerper, Cypc45c antikoerper, P-450MC antikoerper, wu:fb63b04 antikoerper, zfCYP1A antikoerper, zgc:109747 antikoerper, ahh antikoerper, ahrr antikoerper, cp11 antikoerper, cyp1 antikoerper, cyp1a antikoerper, p1-450 antikoerper, p450-c antikoerper, p450dx antikoerper, cytochrome P450 family 1 subfamily A member 1 antikoerper, cytochrome P450 1A1 antikoerper, cytochrome P450, family 1, subfamily a, polypeptide 1 antikoerper, cytochrome P450, family 1, subfamily A, polypeptide 1 antikoerper, cytochrome P450 family 1 subfamily D polypeptide 1 antikoerper, cytochrome P4501A1 antikoerper, polycyclic hydrocarbon-inducible cytochrome P450c antikoerper, cytochrome P450, family 1, subfamily A antikoerper, cytochrome P450, subfamily I (aromatic compound-inducible), polypeptide 1 antikoerper, cytochrome P450 family 1 subfamily A member 1 L homeolog antikoerper, CYP1A1 antikoerper, CpipJ_CPIJ010542 antikoerper, Cyp1a1 antikoerper, cyp1d1 antikoerper, LOC100328613 antikoerper, cyp1a antikoerper, LOC102129994 antikoerper, cyp1a1.L antikoerper
- Hintergrund
- CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke.
- Molekulargewicht
- 58 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha
-