CYP3A4 Antikörper (C-Term)

Produktnummer ABIN635831

Produktdetails anti-CYP3A4 Antikörper

Target: CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP3A4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP3 A43 antibody was raised against the C terminal of CYP3 43

Aufreinigung: Affinity purified

Immunogen: CYP3 A43 antibody was raised using the C terminal of CYP3 43 corresponding to a region with amino acids IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP3A43 Blocking Peptide, catalog no. 33R-4217, is also available for use as a blocking control in assays to test for specificity of this CYP3A43 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 43 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP3A4

Target: CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))

Andere Bezeichnung: CYP3A43 (CYP3A4 Produkte)

Synonyme: CP33 antikoerper, CP34 antikoerper, CYP3A antikoerper, CYP3A3 antikoerper, CYPIIIA3 antikoerper, CYPIIIA4 antikoerper, HLP antikoerper, NF-25 antikoerper, P450C3 antikoerper, P450PCN1 antikoerper, MGC108372 antikoerper, CYP3A80 antikoerper, CYP3A4 antikoerper, CYP3A21 antikoerper, CYPIIIA21 antikoerper, CYP3A12 antikoerper, cytochrome P450 family 3 subfamily A member 4 antikoerper, cytochrome P450 family 3 subfamily A member 43 antikoerper, cytochrome P450 3A4 antikoerper, cytochrome P450, subfamily IIIA, polypeptide 4 antikoerper, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4 antikoerper, cytochrome P450, family 3, subfamily A, polypeptide 4 antikoerper, CYP3A4 antikoerper, CYP3A43 antikoerper, PTRG_01782 antikoerper, PTRG_06060 antikoerper, cyp3a4 antikoerper

Hintergrund: CYP3A43 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis