AGPAT5 Antikörper
-
- Target Alle AGPAT5 Antikörper anzeigen
- AGPAT5 (1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AGPAT5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- AGPAT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLSAFLPARFYQALDDRLYCVYQSMVLFFFENYTGVQILLYGDLPKNKE
- Top Product
- Discover our top product AGPAT5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AGPAT5 Blocking Peptide, catalog no. 33R-8041, is also available for use as a blocking control in assays to test for specificity of this AGPAT5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGPAT5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AGPAT5 (1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5))
- Andere Bezeichnung
- AGPAT5 (AGPAT5 Produkte)
- Synonyme
- AGPAT5 antikoerper, LPAAT-e antikoerper, lpaate antikoerper, 1agpat5 antikoerper, DKFZp469J1022 antikoerper, 1AGPAT5 antikoerper, LPAATE antikoerper, RGD1306405 antikoerper, wu:fc35d05 antikoerper, zgc:154071 antikoerper, 1110013A05Rik antikoerper, D8Ertd319e antikoerper, 1-acylglycerol-3-phosphate O-acyltransferase 5 antikoerper, 1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon) antikoerper, AGPAT5 antikoerper, agpat5 antikoerper, Agpat5 antikoerper
- Hintergrund
- Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis.
- Molekulargewicht
- 42 kDa (MW of target protein)
-