AGPAT5 Antikörper

Produktnummer ABIN635826

Der Kaninchen Polyklonal anti-AGPAT5 Antikörper (ABIN635826) detektiert spezifisch AGPAT5 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für AGPAT5 Antikörper (ABIN635826)

Target: AGPAT5 (1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGPAT5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AGPAT5 Antikörper

Aufreinigung: Affinity purified

Immunogen: AGPAT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLSAFLPARFYQALDDRLYCVYQSMVLFFFENYTGVQILLYGDLPKNKE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AGPAT5 Blocking Peptide, (ABIN5611973), is also available for use as a blocking control in assays to test for specificity of this AGPAT5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGPAT5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AGPAT5

Target: AGPAT5 (1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5))

Andere Bezeichnung: AGPAT5

Hintergrund: Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis.

Molekulargewicht: 42 kDa (MW of target protein)