GALNT4 Antikörper
-
- Target Alle GALNT4 Antikörper anzeigen
- GALNT4 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 4 (GalNAc-T4) (GALNT4))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GALNT4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GALNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGHVFPKRAPYARPNFLQNTARAAEVWMDEYKEHFYNRNPPARKEAYGDI
- Top Product
- Discover our top product GALNT4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GALNT4 Blocking Peptide, catalog no. 33R-9559, is also available for use as a blocking control in assays to test for specificity of this GALNT4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GALNT4 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 4 (GalNAc-T4) (GALNT4))
- Andere Bezeichnung
- GALNT4 (GALNT4 Produkte)
- Synonyme
- GALNAC-T4 antikoerper, GALNACT4 antikoerper, AV011803 antikoerper, polypeptide N-acetylgalactosaminyltransferase 4 antikoerper, polypeptide N-acetylgalactosaminyltransferase 4 L homeolog antikoerper, GALNT4 antikoerper, galnt4.L antikoerper, Galnt4 antikoerper
- Hintergrund
- GALNT4 is a member of the UDP-N-acetyl-alpha-D-galactosamine: polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain.
- Molekulargewicht
- 67 kDa (MW of target protein)
-