WNT9B Antikörper (Middle Region)
-
- Target Alle WNT9B Antikörper anzeigen
- WNT9B (Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WNT9B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WNT9 B antibody was raised against the middle region of WNT9
- Aufreinigung
- Affinity purified
- Immunogen
- WNT9 B antibody was raised using the middle region of WNT9 corresponding to a region with amino acids CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA
- Top Product
- Discover our top product WNT9B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WNT9B Blocking Peptide, catalog no. 33R-1820, is also available for use as a blocking control in assays to test for specificity of this WNT9B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WNT9B (Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B))
- Andere Bezeichnung
- WNT9B (WNT9B Produkte)
- Synonyme
- WNT14B antikoerper, WNT15 antikoerper, WNT9B antikoerper, wnt-9b antikoerper, Wnt14b antikoerper, Wnt15 antikoerper, clf antikoerper, clf1 antikoerper, wnt-14b antikoerper, wnt-15 antikoerper, Wnt family member 9B antikoerper, wingless-type MMTV integration site family member 9B L homeolog antikoerper, protein Wnt-9b antikoerper, wingless-type MMTV integration site family, member 9B antikoerper, WNT9B antikoerper, wnt9b.2.L antikoerper, Wnt9b antikoerper, LOC468296 antikoerper, wnt9b antikoerper
- Hintergrund
- WNT9B is a ligand for members of the frizzled family of seven transmembrane receptors. WNT9B is a probable developmental protein. WNT9B may be a signaling molecule which affects the development of discrete regions of tissues. WNT9B is likely to signal over only few cell diameters.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- WNT Signalweg, Tube Formation
-