FZD10 Antikörper

Produktnummer ABIN635799

Produktdetails anti-FZD10 Antikörper

Target: FZD10 (Frizzled Family Receptor 10 (FZD10))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FZD10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: FZD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FZD10 Blocking Peptide, catalog no. 33R-7152, is also available for use as a blocking control in assays to test for specificity of this FZD10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FZD10

Target: FZD10 (Frizzled Family Receptor 10 (FZD10))

Andere Bezeichnung: FZD10 (FZD10 Produkte)

Synonyme: CD350 antikoerper, FZ-10 antikoerper, Fz10 antikoerper, FzE7 antikoerper, hFz10 antikoerper, cFz-10 antikoerper, Fz-10 antikoerper, Xfr9 antikoerper, Xfz10 antikoerper, frizzled-10 antikoerper, frizzled10 antikoerper, fz10 antikoerper, fze7 antikoerper, hfz10 antikoerper, fk48e04 antikoerper, fz4 antikoerper, fzb antikoerper, wu:fk48e04 antikoerper, zg04 antikoerper, Xfz10A antikoerper, fzd10a antikoerper, Xfz10B antikoerper, Xfz9 antikoerper, fzd10b antikoerper, fzd9 antikoerper, frizzled class receptor 10 antikoerper, frizzled class receptor 10 L homeolog antikoerper, frizzled class receptor 10 S homeolog antikoerper, FZD10 antikoerper, fzd10 antikoerper, Fzd10 antikoerper, fzd10.L antikoerper, fzd10.S antikoerper

Hintergrund: FZD10 is a member of the frizzled family. Members of this family are 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: WNT Signalweg