WNT6 Antikörper (Middle Region)

Produktnummer ABIN635755

Produktdetails anti-WNT6 Antikörper

Target: WNT6 (Wingless-Type MMTV Integration Site Family, Member 6 (WNT6))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WNT6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WNT6 antibody was raised against the middle region of WNT6

Aufreinigung: Affinity purified

Immunogen: WNT6 antibody was raised using the middle region of WNT6 corresponding to a region with amino acids ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WNT6 Blocking Peptide, catalog no. 33R-2692, is also available for use as a blocking control in assays to test for specificity of this WNT6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WNT6

Target: WNT6 (Wingless-Type MMTV Integration Site Family, Member 6 (WNT6))

Andere Bezeichnung: WNT6 (WNT6 Produkte)

Synonyme: WNT6 antikoerper, si:dkey-31m21.2 antikoerper, Wnt6 antikoerper, AA409270 antikoerper, Wnt-6 antikoerper, Xwnt-6 antikoerper, wnt-6 antikoerper, wnt6-A antikoerper, xWnt6 antikoerper, Wnt family member 6 antikoerper, wingless-type MMTV integration site family, member 6b antikoerper, wingless-type MMTV integration site family, member 6 antikoerper, Wnt family member 6 S homeolog antikoerper, WNT6 antikoerper, Wnt6 antikoerper, wnt6b antikoerper, wnt6.S antikoerper

Hintergrund: The WNT family consists of several secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT6 is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The WNT6 protein overexpression may play key roles in carcinogenesis.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: WNT Signalweg, Tube Formation