C1QTNF1 Antikörper (N-Term)

Produktnummer ABIN635746

Produktdetails anti-C1QTNF1 Antikörper

Target: C1QTNF1 (C1q and Tumor Necrosis Factor Related Protein 1 (C1QTNF1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1QTNF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 QTNF1 antibody was raised against the N terminal of C1 TNF1

Aufreinigung: Affinity purified

Immunogen: C1 QTNF1 antibody was raised using the N terminal of C1 TNF1 corresponding to a region with amino acids YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1QTNF1 Blocking Peptide, catalog no. 33R-10194, is also available for use as a blocking control in assays to test for specificity of this C1QTNF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 TNF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1QTNF1

Target: C1QTNF1 (C1q and Tumor Necrosis Factor Related Protein 1 (C1QTNF1))

Andere Bezeichnung: C1QTNF1 (C1QTNF1 Produkte)

Synonyme: C1QTNF1 antikoerper, CTRP1 antikoerper, GIP antikoerper, ZSIG37 antikoerper, 1600017K21Rik antikoerper, Zsig37 antikoerper, Ctrp1 antikoerper, zgc:113062 antikoerper, C1q and tumor necrosis factor related protein 1 antikoerper, C1q and TNF related 1 antikoerper, C1QTNF1 antikoerper, c1qtnf1 antikoerper, C1qtnf1 antikoerper

Hintergrund: C1QTNF1 may be considered a novel adipokine, providing an important framework to further address the physiological functions and mechanisms of the action of this family of secreted glycoproteins in normal and disease states.

Molekulargewicht: 23 kDa (MW of target protein)