SLC39A11 Antikörper
-
- Target Alle SLC39A11 Antikörper anzeigen
- SLC39A11 (Solute Carrier Family 39 (Metal Ion Transporter), Member 11 (SLC39A11))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC39A11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC39 A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARNLAIG
- Top Product
- Discover our top product SLC39A11 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC39A11 Blocking Peptide, catalog no. 33R-3300, is also available for use as a blocking control in assays to test for specificity of this SLC39A11 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC39A11 (Solute Carrier Family 39 (Metal Ion Transporter), Member 11 (SLC39A11))
- Andere Bezeichnung
- SLC39A11 (SLC39A11 Produkte)
- Synonyme
- 1810074D23Rik antikoerper, C17orf26 antikoerper, ZIP11 antikoerper, solute carrier family 39 member 11 antikoerper, solute carrier family 39 (metal ion transporter), member 11 antikoerper, solute carrier family 39, member 11 antikoerper, SLC39A11 antikoerper, slc39a11 antikoerper, Slc39a11 antikoerper
- Hintergrund
- SLC39A11 belongs to the ZIP transporter family. It is a multi-pass membrane protein. SLC39A11 may act as a zinc-influx transporter.
- Molekulargewicht
- 35 kDa (MW of target protein)
-