SLC39A5 Antikörper
-
- Target Alle SLC39A5 Antikörper anzeigen
- SLC39A5 (Solute Carrier Family 39 (Metal Ion Transporter), Member 5 (SLC39A5))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC39A5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC39 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS
- Top Product
- Discover our top product SLC39A5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC39A5 Blocking Peptide, catalog no. 33R-3877, is also available for use as a blocking control in assays to test for specificity of this SLC39A5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC39A5 (Solute Carrier Family 39 (Metal Ion Transporter), Member 5 (SLC39A5))
- Andere Bezeichnung
- SLC39A5 (SLC39A5 Produkte)
- Synonyme
- 1810013D05Rik antikoerper, 2010205A06Rik antikoerper, Zip5 antikoerper, LZT-Hs7 antikoerper, ZIP5 antikoerper, solute carrier family 39 member 5 antikoerper, solute carrier family 39 (metal ion transporter), member 5 antikoerper, SLC39A5 antikoerper, Slc39a5 antikoerper
- Hintergrund
- Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-