Unc5c Antikörper
-
- Target Alle Unc5c Antikörper anzeigen
- Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Unc5c Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- UNC5 C antibody was raised using a synthetic peptide corresponding to a region with amino acids WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE
- Top Product
- Discover our top product Unc5c Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UNC5C Blocking Peptide, catalog no. 33R-10004, is also available for use as a blocking control in assays to test for specificity of this UNC5C antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))
- Andere Bezeichnung
- UNC5C (Unc5c Produkte)
- Synonyme
- UNC5C antikoerper, UNC5H3 antikoerper, 6030473H24 antikoerper, AI047720 antikoerper, B130051O18Rik antikoerper, Unc5h3 antikoerper, rcm antikoerper, wu:fb03d07 antikoerper, unc-5 netrin receptor C antikoerper, UNC5C antikoerper, Unc5c antikoerper, unc5c antikoerper
- Hintergrund
- UNC5C belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin, they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
- Molekulargewicht
- 103 kDa (MW of target protein)
-