CYP46A1 Antikörper (C-Term)

Produktnummer ABIN635703

Produktdetails anti-CYP46A1 Antikörper

Target: CYP46A1 (Cytochrome P450, Family 46, Subfamily A, Polypeptide 1 (CYP46A1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP46A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP46 A1 antibody was raised against the C terminal of CYP46 1

Aufreinigung: Affinity purified

Immunogen: CYP46 A1 antibody was raised using the C terminal of CYP46 1 corresponding to a region with amino acids YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP46A1 Blocking Peptide, catalog no. 33R-10280, is also available for use as a blocking control in assays to test for specificity of this CYP46A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP40 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP46A1

Target: CYP46A1 (Cytochrome P450, Family 46, Subfamily A, Polypeptide 1 (CYP46A1))

Andere Bezeichnung: CYP46A1 (CYP46A1 Produkte)

Synonyme: CP46 antikoerper, CYP46 antikoerper, CYP46A1 antikoerper, zgc:109896 antikoerper, MGC147389 antikoerper, Cyp46 antikoerper, cytochrome P450 family 46 subfamily A member 1 antikoerper, cytochrome P450 family 46 subfamily A member 1 L homeolog antikoerper, cytochrome P450, family 46, subfamily A, polypeptide 1, tandem duplicate 1 antikoerper, cytochrome P450, family 46 antikoerper, cytochrome P450 46A1 antikoerper, cytochrome P450, family 46, subfamily a, polypeptide 1 antikoerper, cholesterol 24-hydroxylase antikoerper, cytochrome P450, family 46, subfamily A, polypeptide 1 antikoerper, CYP46A1 antikoerper, cyp46a1.L antikoerper, cyp46a1.1 antikoerper, cyp46a1 antikoerper, PTRG_08343 antikoerper, PTRG_09667 antikoerper, Cyp46a1 antikoerper, Sgly_1093 antikoerper

Hintergrund: CYP46A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molekulargewicht: 57 kDa (MW of target protein)