RNASE1 Antikörper

Produktnummer ABIN635680

Produktdetails anti-RNASE1 Antikörper

Target: RNASE1 (Ribonuclease, RNase A Family, 1 (Pancreatic) (RNASE1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNASE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RNASE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNASE1 Blocking Peptide, catalog no. 33R-5686, is also available for use as a blocking control in assays to test for specificity of this RNASE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNASE1

Target: RNASE1 (Ribonuclease, RNase A Family, 1 (Pancreatic) (RNASE1))

Andere Bezeichnung: RNASE1 (RNASE1 Produkte)

Synonyme: RNASE1 antikoerper, RNS1 antikoerper, ATRNS1 antikoerper, RIBONUCLEASE 1 antikoerper, T17M13.16 antikoerper, T17M13_16 antikoerper, ribonuclease 1 antikoerper, RIB1 antikoerper, AI574248 antikoerper, Rib-1 antikoerper, Rib1 antikoerper, SRN antikoerper, ribonuclease A family member 1, pancreatic antikoerper, ribonuclease pancreatic-like antikoerper, ribonuclease A family member k6 antikoerper, Ribonuclease 1 antikoerper, ribonuclease 1 antikoerper, ribonuclease, RNase A family, 1 (pancreatic) antikoerper, ribonuclease pancreatic antikoerper, RNASE1 antikoerper, LOC475395 antikoerper, RNASE6 antikoerper, Rnase1 antikoerper, RNS1 antikoerper, LOC101113761 antikoerper

Hintergrund: This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases.

Molekulargewicht: 15 kDa (MW of target protein)