SLC10A1 Antikörper
-
- Target Alle SLC10A1 Antikörper anzeigen
- SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC10A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC10 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY
- Top Product
- Discover our top product SLC10A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC10A1 Blocking Peptide, catalog no. 33R-9542, is also available for use as a blocking control in assays to test for specificity of this SLC10A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))
- Andere Bezeichnung
- SLC10A1 (SLC10A1 Produkte)
- Synonyme
- Ntcp antikoerper, NTCP antikoerper, Ntcp1 antikoerper, SBACT antikoerper, solute carrier family 10 (sodium/bile acid cotransporter family), member 1 antikoerper, solute carrier family 10 member 1 antikoerper, Slc10a1 antikoerper, SLC10A1 antikoerper
- Hintergrund
- Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids.
- Molekulargewicht
- 38 kDa (MW of target protein)
-