SLC10A1 Antikörper (C-Term)
-
- Target Alle SLC10A1 Antikörper anzeigen
- SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))
-
Bindungsspezifität
- AA 296-336, C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC10A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Sodium/bile acid cotransporter(SLC10A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- EGLLFIIIFR CYLKIKPQKD QTKITYKAAA TEDATPAALE K
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Sodium/bile acid cotransporter(SLC10A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: solute carrier family 10 (sodium/bile acid cotransporter family), member 1
Protein Name: Sodium/bile acid cotransporter - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK), different from the related human sequence by eighteen amino acids, and from the related rat sequence by three amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product SLC10A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))
- Andere Bezeichnung
- SLC10A1 (SLC10A1 Produkte)
- Synonyme
- Ntcp antikoerper, NTCP antikoerper, Ntcp1 antikoerper, SBACT antikoerper, solute carrier family 10 (sodium/bile acid cotransporter family), member 1 antikoerper, solute carrier family 10 member 1 antikoerper, Slc10a1 antikoerper, SLC10A1 antikoerper
- Hintergrund
-
Na+-taurocholate cotransporting polypeptide (NTCP), also known as SLC10A1 (Solute carrier family 10, member 1), is the major bile acid uptake system in human hepatocytes. NTCP and the ileal transporter ASBT (apical sodium-dependent bile acid transporter) are two sodium-dependent transporters critical for the enterohepatic circulation of bile acids. The hASBT gene is known to be activated by the glucocorticoid receptor (GR). Ho RH et al. indicates functionally important polymorphisms in NTCP exist and that the like lihood of being carriers of such polymorphisms is dependent on ethnicity.
Synonyms: Cell growth-inhibiting gene 29 protein antibody|Growth inhibiting protein 29 antibody|Na / bile acid cotransporter antibody|Na / taurocholate transport protein antibody|Na(+)/bile acid cotransporter antibody|Na(+)/taurocholate transport protein antibody|Na/taurocholate cotransporting polypeptide antibody|NTCP antibody|NTCP_HUMAN antibody|NTCP1 antibody| SLC10A1 antibody|Sodium/bile acid cotransporter antibody|Sodium/taurocholate cotransporter antibody|Sodium/taurocholate cotransporting polypeptide antibody|Solute carrier family 10 (sodium/bile acid cotransporter family) member 1 antibody|Solute carrier family 10 member 1 antibody - Gen-ID
- 20493
- UniProt
- O08705
-