Coxsackie Adenovirus Receptor Antikörper (N-Term)

Produktnummer ABIN635555

Produktdetails anti-Coxsackie Adenovirus Receptor Antikörper

Target: Coxsackie Adenovirus Receptor (CXADR) (Coxsackie Virus and Adenovirus Receptor (CXADR))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Coxsackie Adenovirus Receptor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CXADR antibody was raised against the N terminal of CXADR

Aufreinigung: Affinity purified

Immunogen: CXADR antibody was raised using the N terminal of CXADR corresponding to a region with amino acids ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CXADR Blocking Peptide, catalog no. 33R-4065, is also available for use as a blocking control in assays to test for specificity of this CXADR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXADR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Coxsackie Adenovirus Receptor

Target: Coxsackie Adenovirus Receptor (CXADR) (Coxsackie Virus and Adenovirus Receptor (CXADR))

Andere Bezeichnung: CXADR (CXADR Produkte)

Synonyme: CAR antikoerper, CAR4/6 antikoerper, HCAR antikoerper, Car1 antikoerper, car antikoerper, cb331 antikoerper, fb76g12 antikoerper, wu:fb76g12 antikoerper, 2610206D03Rik antikoerper, AU016810 antikoerper, AW553441 antikoerper, MCAR antikoerper, MCVADR antikoerper, hcar antikoerper, xCAR antikoerper, CXADR antikoerper, CXADR, Ig-like cell adhesion molecule antikoerper, coxsackie virus and adenovirus receptor antikoerper, CXADR, Ig-like cell adhesion molecule L homeolog antikoerper, CXADR antikoerper, Cxadr antikoerper, cxadr antikoerper, cxadr.L antikoerper

Hintergrund: The protein encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Pseudogenes of this gene are found on chromosomes 15, 18, and 21.

Molekulargewicht: 38 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization