Junctophilin 2 Antikörper (Middle Region)

Produktnummer ABIN635496

Produktdetails anti-Junctophilin 2 Antikörper

Target: Junctophilin 2 (JPH2)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Junctophilin 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Junctophilin 2 antibody was raised against the middle region of JPH2

Aufreinigung: Affinity purified

Immunogen: Junctophilin 2 antibody was raised using the middle region of JPH2 corresponding to a region with amino acids ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Junctophilin 2 Blocking Peptide, catalog no. 33R-1407, is also available for use as a blocking control in assays to test for specificity of this Junctophilin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JPH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Junctophilin 2

Target: Junctophilin 2 (JPH2)

Andere Bezeichnung: Junctophilin 2 (JPH2 Produkte)

Synonyme: CMH17 antikoerper, JP-2 antikoerper, JP2 antikoerper, jp antikoerper, 1110002E14Rik antikoerper, Jp2 antikoerper, junctophilin 2 antikoerper, junctophilin-2 antikoerper, JPH2 antikoerper, LOC100461095 antikoerper, LOC610874 antikoerper, Jph2 antikoerper

Hintergrund: Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH2 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane.

Molekulargewicht: 74 kDa (MW of target protein)