KIRREL Antikörper

Produktnummer ABIN635461

Produktdetails anti-KIRREL Antikörper

Target: KIRREL (NEPH1) (Kin of IRRE Like 1 (NEPH1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIRREL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: KIRREL antibody was raised using a synthetic peptide corresponding to a region with amino acids FLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIRREL Blocking Peptide, catalog no. 33R-2959, is also available for use as a blocking control in assays to test for specificity of this KIRREL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIRREL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIRREL

Target: KIRREL (NEPH1) (Kin of IRRE Like 1 (NEPH1))

Andere Bezeichnung: KIRREL (NEPH1 Produkte)

Synonyme: NEPH1 antikoerper, 6720469N11Rik antikoerper, Kirrel1 antikoerper, Neph1 antikoerper, nephrin related antikoerper, kirre like nephrin family adhesion molecule 1 antikoerper, kin of IRRE like (Drosophila) antikoerper, Smp_104390 antikoerper, Smp_140170 antikoerper, KIRREL1 antikoerper, Kirrel antikoerper, Kirrel1 antikoerper

Hintergrund: KIRREL (NEPH1) is a member of the nephrin-like protein family, which includes NEPH2 and NEPH3. The cytoplasmic domains of these proteins interact with the C terminus of podocin (NPHS2), and the genes are expressed in kidney podocytes, cells involved in ensuring size- and charge-selective ultrafiltration.

Molekulargewicht: 66 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization