ATP6V0A1 Antikörper (N-Term)

Produktnummer ABIN635431

Produktdetails anti-ATP6V0A1 Antikörper

Target: ATP6V0A1 (ATPase, H+ Transporting, Lysosomal V0 Subunit A1 (ATP6V0A1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP6V0A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP6 V6 1 antibody was raised against the N terminal of ATP6 6 1

Aufreinigung: Affinity purified

Immunogen: ATP6 V6 1 antibody was raised using the N terminal of ATP6 6 1 corresponding to a region with amino acids RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP6V0A1 Blocking Peptide, catalog no. 33R-7853, is also available for use as a blocking control in assays to test for specificity of this ATP6V0A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP6V0A1

Target: ATP6V0A1 (ATPase, H+ Transporting, Lysosomal V0 Subunit A1 (ATP6V0A1))

Andere Bezeichnung: ATP6V0A1 (ATP6V0A1 Produkte)

Synonyme: ATP6N1 antikoerper, ATP6N1A antikoerper, Stv1 antikoerper, VPP1 antikoerper, Vph1 antikoerper, a1 antikoerper, AA959968 antikoerper, ATP6a1 antikoerper, Atp6n1 antikoerper, Atp6n1a antikoerper, Atpv0a1 antikoerper, Vpp-1 antikoerper, Vpp1 antikoerper, A1 antikoerper, wu:fj37e01 antikoerper, zgc:112214 antikoerper, atp6v0a1 antikoerper, wu:fc25b09 antikoerper, zgc:76965 antikoerper, ATPase H+ transporting V0 subunit a1 antikoerper, ATPase, H+ transporting, lysosomal V0 subunit A1 antikoerper, si:ch73-173p19.2 antikoerper, ATPase, H+ transporting, lysosomal V0 subunit a1 L homeolog antikoerper, ATPase, H+ transporting, lysosomal V0 subunit a1b antikoerper, ATPase, H+ transporting, lysosomal V0 subunit a1a antikoerper, ATP6V0A1 antikoerper, Atp6v0a1 antikoerper, si:ch73-173p19.2 antikoerper, atp6v0a1.L antikoerper, atp6v0a1b antikoerper, atp6v0a1a antikoerper

Hintergrund: ATP6V0A1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. ATP6V0A1 is one of three A subunit proteins and it is associated with clathrin-coated vesicles.

Molekulargewicht: 96 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport