ATP2A3 Antikörper (Middle Region)

Produktnummer ABIN635430

Produktdetails anti-ATP2A3 Antikörper

Target: ATP2A3 (ATPase, Ca++ Transporting, Ubiquitous (ATP2A3))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP2A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP2 A3 antibody was raised against the middle region of ATP2 3

Aufreinigung: Affinity purified

Immunogen: ATP2 A3 antibody was raised using the middle region of ATP2 3 corresponding to a region with amino acids LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP2A3 Blocking Peptide, catalog no. 33R-5064, is also available for use as a blocking control in assays to test for specificity of this ATP2A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP2A3

Target: ATP2A3 (ATPase, Ca++ Transporting, Ubiquitous (ATP2A3))

Andere Bezeichnung: ATP2A3 (ATP2A3 Produkte)

Synonyme: serca3 antikoerper, si:dkey-205l20.1 antikoerper, ATP2A3 antikoerper, Atp2a3 antikoerper, SERCA3 antikoerper, SERCA3b antikoerper, Serca3 antikoerper, SERCA antikoerper, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 L homeolog antikoerper, ATPase, Ca++ transporting, ubiquitous antikoerper, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 antikoerper, atp2a3.L antikoerper, atp2a3 antikoerper, ATP2A3 antikoerper, Atp2a3 antikoerper

Hintergrund: ATP2A3 is one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.

Molekulargewicht: 109 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Ribonucleoside Biosynthetic Process